ProGlyProt ID BU149 Organism Information Organism Name Clostridium tyrobutyricum ATCC 25755 Domain Bacteria Classification Family: Clostridiaceae Order: Clostridiales Class: Clostridia Division or phylum: "Firmicutes" Taxonomic ID (NCBI) 1519 Genome Sequence (s) GeneBank EMBL AJ242662 Gene Information Gene Name fla NCBI Gene ID Protein Information Protein Name Flagellin UniProtKB/SwissProt ID P80583 NCBI RefSeq EMBL-CDS CAB44444.1 UniProtKB Sequence >sp|P80583|FLA_CLOTY Flagellin (Fragment) OS=Clostridium tyrobutyricum GN=fla PE=1 SV=2 MIINHNLMANNALRNMNVNSNNASKAMEKLSSGLRINRAGDDAAGLAISEKMRGQINGLN QASSNAQDSISLIQTAEGALNETHSILQRMRTLAVQSSNDTNTTTDRSAIQDEVNQLTDE IDRIANTTEFNTQKLLDGSKVGLVDAKDADASVQLNTSANISLASNFSTTSATGIADSFT VTITRTHGTAGATFASTDYDVALVGGTELIEHSSSSLTYDTKAINLVGMIKCFSIRTNDT IRKVSHVRTVKALSMQIGAIVTNMLIGINSMKATDIGVRNTSGKALDISTASKATGAITQ INNAIETVSTQRSKLGAYQNRLEHTINNLGTSSENLTSAESRIRDVDMASEMSEYSKNNI LSQTAQAMLAQANQQTQ Sequence length 377 AA Subcellular Location Secreted (flagellum) Function Flagellin is the subunit protein which polymerizes to form the filaments of flagella. Glycosylation Status Glycosylation Type Technique(s) used for Glycosylation Detection Literatures Reference(s) 1) Bedouet, L., Arnold, F., Robreau, G., Batina, P., Talbot, F. and Binet, A. (1998) Evidence for an heterogeneous glycosylation of the Clostridium tyrobutyricum ATCC 25755 flagellin. Microbios, 94, 183-192. [PubMed: 9853380] 2) Bedouet, L., Arnold, F., Robreau, G., Batina, P., Talbot, F. and Malcoste, R. (1998) Partial analysis of the flagellar antigenic determinant recognized by a monoclonal antibody to Clostridium tyrobutyricum. Microbiol Immunol, 42, 87-95. [PubMed: 9572040] 3) Beguin, P. and Lemaire, M. (1996) The cellulosome: an exocellular, multiprotein complex specialized in cellulose degradation. Crit Rev Biochem Mol Biol, 31, 201-236. [PubMed: 8817076] 4) Jarrell, K.F., Bayley, D.P. and Kostyukova, A.S. (1996) The archaeal flagellum: a unique motility structure. J Bacteriol, 178, 5057-5064. [PubMed: 8752319] Year of Identification 1998