ProGlyProt ID BU142 Organism Information Organism Name Chloroflexus aurantiacus Domain Bacteria Classification Family: Chloroflexaceae Order: Chloroflexales Class: Chloroflexi Division or phylum: "Chloroflexi" Taxonomic ID (NCBI) 324602 Genome Sequence (s) GeneBank U78046.1 EMBL U78046 Gene Information Gene Name Caur_1950 NCBI Gene ID 5826401 Protein Information Protein Name Auracyanin-B1 (22 kDa) UniProtKB/SwissProt ID P27197 NCBI RefSeq YP_001635554.1 EMBL-CDS AAB38318.1 UniProtKB Sequence >sp|P27197|AURB_CHLAA Auracyanin-B OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=Caur_1950 PE=1 SV=2 MSWRGSGRSNFRSRSSSNGGSTFSGGSAGGPPLIVMMGLAFGAGLIMLIVMIASNATAGG FVAATPRPTATPRPTAAPAPTQPPAAQPTTAPATQAANAPGGSNVVNETPAQTVEVRAAP DALAFAQTSLSLPANTVVRLDFVNQNNLGVQHNWVLVNGGDDVAAAVNTAAQNNADALFV PPPDTPNALAWTAMLNAGESGSVTFRTPAPGTYLYICTFPGHYLAGMKGTLTVTP Sequence length 235 AA (signal and pro-peptide 80 AA) Subcellular Location Membrane associated (peripheral) Function Blue copper protein. It is involved in photosynthetic electron transfer in the anoxygenic photosynthetic bacterium. Can donate electrons to cytochrome c-554. It has an intense absorption band near 600 nm in the oxidized form. Contains a type 1 copper(II) ion characterized by an intense blue color. Glycosylation Status Glycosylation Type N(Asn),(Ser/Thr)- linked Technique(s) used for Glycosylation Detection Thymol sulfuric acid-staining Literatures Reference(s) 1) McManus, J.D., Brune, D.C., Han, J., Sanders-Loehr, J., Meyer, T.E., Cusanovich, M.A., Tollin, G. and Blankenship, R.E. (1992) Isolation, characterization, and amino acid sequences of auracyanins, blue copper proteins from the green photosynthetic bacterium Chloroflexus aurantiacus. J Biol Chem, 267, 6531-6540. [PubMed: 1313011] Year of Identification 1992