ProGlyProt ID BU141 Organism Information Organism Name Chlamydia trachomatis serovar L2 (strain 434/Bu) Domain Bacteria Classification Family: Chlamydiaceae Order: Chlamydiales Class: Chlamydiae Division or phylum: "Chlamydiae" Taxonomic ID (NCBI) 471472 Genome Sequence (s) GeneBank AM884176.1 EMBL AM884176 Gene Information Gene Name ompA (CTL0050) NCBI Gene ID 5858320 Protein Information Protein Name Major outer membrane protein (MOMP, 40 kDa) UniProtKB/SwissProt ID P06597 NCBI RefSeq YP_001654141.1 EMBL-CDS CAP03494.1 UniProtKB Sequence >sp|P06597|MOMP_CHLT2 Major outer membrane porin OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ompA PE=1 SV=1 MKKLLKSVLVFAALSSASSLQALPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISM RMGYYGDFVFDRVLQTDVNKEFQMGAKPTTATGNAAAPSTCTARENPAYGRHMQDAEMFT NAAYMALNIWDRFDVFCTLGATSGYLKGNSASFNLVGLFGDNENHATVSDSKLVPNMSLD QSVVELYTDTTFAWSAGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKP KGYVGQEFPLDLKAGTDGVTGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDA DTIRIAQPKSATTVFDVTTLNPTIAGAGDVKASAEGQLGDTMQIVSLQLNKMKSRKSCGI AVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF Sequence length 394 AA Subcellular Location Membrane associated Function The MOMP (40 kDa protein) is the principal structural protein of the EB (infectious elementary body). Through disulfide-mediated interactions, the MOMP provides the structural integrity to the extracellular infectious form and performs a porin-like function when Chlamydiae are intracellular and metabolically active. The serological specificity of the organism resides in MOMP, and antibodies raised against MOMP neutralize infectivity of Chlamydia. Glycosylation Status Glycosylation Type N(Asn)- linked Technique(s) used for Glycosylation Detection Change in SDS-PAGE mobility after periodate oxidation, polysaccharide staining with p-phenylenediamine, rapid migration on SDS-PAGE after PNGaseF treatment, lectin binding (ConA, WGA, DBA), and autoradiography after metabolic labeling with [3H]glucosamine. Literatures Reference(s) 1) Kuo, C., Takahashi, N., Swanson, A.F., Ozeki, Y. and Hakomori, S. (1996) An N-linked high-mannose type oligosaccharide, expressed at the major outer membrane protein of Chlamydia trachomatis, mediates attachment and infectivity of the microorganism to HeLa cells. J Clin Invest, 98, 2813-2818. [PubMed: 8981929] 2) Swanson, A.F. and Kuo, C.C. (1994) Binding of the glycan of the major outer membrane protein of Chlamydia trachomatis to HeLa cells. Infect Immun, 62, 24-28. [PubMed: 8262634] 3) Swanson, A.F. and Kuo, C.C. (1991) Evidence that the major outer membrane protein of Chlamydia trachomatis is glycosylated. Infect Immun, 59, 2120-2125. [PubMed: 1645328] Year of Identification 1991