Search ProCGP (Characterized Glycoproteins) Search ProUGP (Uncharacterized Glycoproteins) Example Display Page Crystal Structures Homology Models Map Sequon Glyseq Extractor Blast Recent Reviews Related Tools & Databases Bibliography ProGlycProt ProGlyProt ID BU136 Organism Information Organism Name Cellulomonas fimi ATCC 484 Domain Bacteria Classification Family: Cellulomonadaceae Suborder: Micrococcineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1708 Genome Sequence (s) GeneBank EMBL M15823 Gene Information Gene Name cenA NCBI Gene ID Protein Information Protein Name CenA (Endoglucanase A) UniProtKB/SwissProt ID P07984 NCBI RefSeq EMBL-CDS AAA23084.1 UniProtKB Sequence >sp|P07984|GUNA_CELFI Endoglucanase A OS=Cellulomonas fimi GN=cenA PE=1 SV=1 MSTRRTAAALLAAAAVAVGGLTALTTTAAQAAPGCRVDYAVTNQWPGGFGANVTITNLGD PVSSWKLDWTYTAGQRIQQLWNGTASTNGGQVSVTSLPWNGSIPTGGTASFGFNGSWAGS NPTPASFSLNGTTCTGTVPTTSPTPTPTPTTPTPTPTPTPTPTPTVTPQPTSGFYVDPTT QGYRAWQAASGTDKALLEKIALTPQAYWVGNWADASHAQAEVADYTGRAVAAGKTPMLVV YAIPGRDCGSHSGGGVSESEYARWVDTVAQGIKGNPIVILEPDALAQLGDCSGQGDRVGF LKYAAKSLTLKGARVYIDAGHAKWLSVDTPVNRLNQVGFEYAVGFALNTSNYQTTADSKA YGQQISQRLGGKKFVIDTSRNGNGSNGEWCNPRGRALGERPVAVNDGSGLDALLWVKLPG ESDGACNGGPAAGQWWQEIALEMARNARW Sequence length 449 AA Subcellular Location Function Endo-β-1,4-glucanase A. EC=3.2.1.4. Involved in cellulose hydrolysis. Glycosylation Status Glycosylation Type O(Thr)- linked Technique(s) used for Glycosylation Detection PAS-staining and ConA binding Literatures Reference(s) 1) Ong, E., Kilburn, D.G., Miller, R.C., Jr. and Warren, R.A. (1994) Streptomyces lividans glycosylates the linker region of a beta-1,4-glycanase from Cellulomonas fimi. J Bacteriol, 176, 999-1008. [PubMed: 8106343] 2) Gilkes, N.R., Langsford, M.L., Kilburn, D.G., Miller, R.C., Jr. and Warren, R.A. (1984) Mode of action and substrate specificities of cellulases from cloned bacterial genes. J Biol Chem, 259, 10455-10459. [PubMed: 6432782] Year of Identification 1994