ProGlyProt ID BU110 Organism Information Organism Name Bacillus anthracis str. Ames (Sterne 7702) Domain Bacteria Classification Family: Bacillaceae Order: Bacillales Class: Bacilli (or Firmibacteria) Division or phylum: "Firmicutes" Taxonomic ID (NCBI) 1392 Genome Sequence (s) GeneBank AE016879.1 EMBL AE016879 Gene Information Gene Name bclA (BA_1222) NCBI Gene ID 1084744 Protein Information Protein Name BclA (collagen-like protein) UniProtKB/SwissProt ID Q81JD7 NCBI RefSeq NP_843695.1 EMBL-CDS AAP25181.1 UniProtKB Sequence >tr|Q81JD7|Q81JD7_BACAN BclA protein OS=Bacillus anthracis GN=bclA PE=1 SV=1 MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGP TGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGD TGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGP TGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGATGLTGP TGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETG FYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVI VTGLGLSLALGTSASIIIEKVA Sequence length 382 AA Subcellular Location Surface Function It is the major glycoprotein of exosporium and also the immunodominant protein of the spore surface. Exosporium is a loose fitting layer enclosing the spore. BclA forms the filaments of the external hair-like nap of the exosporium. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection ECL Glycoprotein detection kit and chemical deglycosylation using trifluoromethanesulfonic acid (TFMS). Literatures Reference(s) 1) Oberli, M.A., Tamborrini, M., Tsai, Y.H., Werz, D.B., Horlacher, T., Adibekian, A., Gauss, D., Moller, H.M., Pluschke, G. and Seeberger, P.H. (2010) Molecular analysis of carbohydrate-antibody interactions: case study using a Bacillus anthracis tetrasaccharide. J Am Chem Soc, 132, 10239-10241. [PubMed: 20614885] 2) Tamborrini, M., Holzer, M., Seeberger, P.H., Schurch, N. and Pluschke, G. (2010) Anthrax spore detection by a luminex assay based on monoclonal antibodies that recognize anthrose-containing oligosaccharides. Clin Vaccine Immunol, 17, 1446-1451. [PubMed: 20660139] 3) Dong, S., Chesnokova, O.N., Turnbough, C.L., Jr. and Pritchard, D.G. (2009) Identification of the UDP-N-acetylglucosamine 4-epimerase involved in exosporium protein glycosylation in Bacillus anthracis. J Bacteriol, 191, 7094-7101. [PubMed: 19749053] 4) Saksena, R., Adamo, R. and Kovac, P. (2006) Synthesis of the tetrasaccharide side chain of the major glycoprotein of the Bacillus anthracis exosp Year of Identification 2002