ProGlyProt ID BU109 Organism Information Organism Name Bacillus anthracis Domain Bacteria Classification Family: Bacillaceae Order: Bacillales Class: Bacilli (or Firmibacteria) Division or phylum: "Firmicutes" Taxonomic ID (NCBI) 1392 Genome Sequence (s) GeneBank AE016879.1 EMBL AE016879 Gene Information Gene Name bclB (BA_2450) NCBI Gene ID 1084937 Protein Information Protein Name BclB (collagen-like protein) UniProtKB/SwissProt ID Q81QH5 NCBI RefSeq NP_844826.1 EMBL-CDS AAP26312.1 UniProtKB Sequence >tr|Q81QH5|Q81QH5_BACAN Spore surface glycoprotein BclB OS=Bacillus anthracis GN=blcB PE=4 SV=1 MKQNDKLWLDKGIIGPENIGPTFPVLPPIHIPTGITGATGATGITGATGPTGTTGATGAT GITGVTGATGITGVTGATGITGVTGATGITGVTGPTGITGATGPTGITGATGPAGITGVT GPTGITGATGPTGTTGVTGPTGDTGLAGATGPTGATGLAGATGPTGDTGATGPTGATGLA GATGPTGATGLTGATGATGATGGGAIIPFASGTTPALLVNAVLANTGTLLGFGFSQPGIA PGVGGTLTILPGVVGDYAFVAPRDGIITSLAGFFSATAALAPLTPVQIQMQIFIAPAASN TFTPVAPPLLLTPALPAIAIGTTATGIQAYNVPVVAGDKILVYVSLTGASPIAAVAGFVS AGLNIV Sequence length 366 AA Subcellular Location Surface Function Spore surface glycoprotein. It is the constituent of the exosporium, a loose covering around the spore. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Gas chromatography-mass spectrometry (GC-MS) and tandem mass spectrometry (tandem MS) Literatures Reference(s) 1) Waller, L.N., Stump, M.J., Fox, K.F., Harley, W.M., Fox, A., Stewart, G.C. and Shahgholi, M. (2005) Identification of a second collagen-like glycoprotein produced by Bacillus anthracis and demonstration of associated spore-specific sugars. J Bacteriol, 187, 4592-4597. [PubMed: 15968070] Year of Identification 2005