| ProGlyProt ID | BU108 |
| Organism Information |
| Organism Name | Azospirillum brasilense Sp7 |
| Domain | Bacteria |
| Classification | Family: Rhodospirillaceae
Order: Rhodospirillales
Class: Alphaproteobacteria
Division or phylum: "Proteobacteria" |
| Taxonomic ID (NCBI) | 192 |
| Genome Sequence (s) |
| GeneBank | |
| EMBL | U26679 |
| Gene Information |
| Gene Name | laf1 |
| NCBI Gene ID | |
| Protein Information |
| Protein Name | Flagellin Laf1 |
| UniProtKB/SwissProt ID | Q43896 |
| NCBI RefSeq | |
| EMBL-CDS | AAA86521.1 |
| UniProtKB Sequence | >tr|Q43896|Q43896_AZOBR Flagellin Laf1 OS=Azospirillum brasilense GN=laf1 PE=4 SV=1
MASIMTNTSAMTALQTVRRVTDDLATTQDRISTGLKVNNAKDNAAYWSIATTMRADVAGF
KAVKESLELGSGTTNTASVASKNIVENLQTLKARVIAGQTNGVDKSLIQNDIDQLVKLVK
GAAADASFNGDNLLRITYSNDGTAKDQNVDILASLSRSAGTVDPSYISFQRQDMQVTSIV
GKATIEQQVDSTNDLKASVGIAIGAPDTTFIDGQNLGLGNLTLNVTNEAGTKTAVTVDLS
GIDYTTDLATTQGLIETAVNAALTTAGGDFQVAFNGDKLEFTDQDLNTDGNFTAKVDSLW
VGSKESDAFGGLADLTQIDVTSNATKSLEVINGLLDKAIGKAAVIGSIENRVSVQNDFVS
KLTDSMNKGIGSLVDADMNEESSRLQALQVQQQLATQALSIANQGPQNILSLFR |
| Sequence length | 414 AA |
| Subcellular Location | Flagellum |
| Function | Flagellin is the subunit protein which polymerizes to form the filaments of flagella. |
| Glycosylation Status |
| Glycosylation Type | Information currently not available with us. |
| Technique(s) used for Glycosylation Detection | PAS-staining, chemical (TFMS) deglycosylation, DIG glycan detection, and sugar-specific monoclonal antibody in immunogold labelling coupled with TEM. |
| Literatures |
| Reference(s) | 1) Moens, S., Michiels, K. and Vanderleyden, J. (1995) Glycosylation of the flagellin of the polar flagellum of Azospirillum brasilense, a Gram-negative nitrogen-fixing bacterium. Microbiology, 141, 2651-2657 |
| Year of Identification | 1995 |
