ProGlyProt ID AU149 Organism Information Organism Name Thermoplasma volcanium DSM 4299 Domain Archaea Classification Family: Thermoplasmataceae Order: Thermoplasmatales Class: Thermoplasmata Division or phylum: "Euryarchaeota" Taxonomic ID (NCBI) 273116 Genome Sequence (s) GeneBank BA000011.4 EMBL BA000011 Gene Information Gene Name TVN0607 NCBI Gene ID 1441713 Protein Information Protein Name Flagellin B1 (41 kDa) UniProtKB/SwissProt ID P57719 NCBI RefSeq NP_111126.1 EMBL-CDS BAB59749.1 UniProtKB Sequence >sp|P57719|FLA1_THEVO Flagellin B1 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / IFO 15438 / JCM 9571 / GSS1) GN=TV0607 PE=1 SV=2 MNKLLRKVRKAFSLKADNKAETGIGTLIVFIAMVLVAAVAATVLVHTAGTLQQKATSTGS QTTQQVSTGIQVNSIYGLDSNKSVPTHGVIEWLAIQISITAGSSPINLANVTISLTYHGV SASLTYVGLENIGNATVTNDVYGFNSAVGGTNNVFNSSYFKTINGASNGSKHFAILVLSD PTNSMTAQYPVISYEDQVDLLVNVSAVFGGITEGQAVSGEVQAPVGSPGVIQFTAPESFV SDVIQLQ Sequence length 247 AA Subcellular Location Secreted Function Flagellin is the subunit protein which polymerizes to form the filaments of archaeal flagella. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection PAS staining. Literatures Reference(s) 1) Faguy, D.M., Bayley, D.P., Kostyukova, A.S., Thomas, N.A. and Jarrell, K.F. (1996) Isolation and characterization of flagella and flagellin proteins from the Thermoacidophilic archaea Thermoplasma volcanium and Sulfolobus shibatae. J Bacteriol, 178, 902-905. [PubMed: 8550530] Year of Identification 1996