ProGlyProt ID AU146 Organism Information Organism Name Thermococcus litoralis DSM 5473 Domain Archaea Classification Family: Thermococcaceae Order: Thermococcales Class: Thermococci or Protoarchaea Division or phylum: "Euryarchaeota" Taxonomic ID (NCBI) 2265 Genome Sequence (s) GeneBank EMBL AF012836 Gene Information Gene Name malE NCBI Gene ID Protein Information Protein Name TMBP (Trehalose/maltose binding protein) UniProtKB/SwissProt ID Q7LYW7 NCBI RefSeq EMBL-CDS AAC38136.1 UniProtKB Sequence >tr|Q7LYW7|Q7LYW7_THELI Trehalose/maltose binding protein OS=Thermococcus litoralis GN=malE PE=4 SV=1 MNVKKVLLGLFLVGVLGIAVVASGCIGGQQTSTVTSTPTETSLQGKIVFAVGGAPNEIEY WKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIAS GWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYS KPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKD GKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYA WGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYS VQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKY VNSALAGKISPQEALDKAQKEAEELVKQYS Sequence length 450 AA Subcellular Location Membrane associated Function This soluble protein is involved in ABC transport of trehalose and maltose. It has got an exceptionally high substrate-binding affinity and transports the substrates at 85 deg C. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection PAS-staining and ConA-Sepharose affinity chromatography. Literatures Reference(s) 1) Greller, G., Riek, R. and Boos, W. (2001) Purification and characterization of the heterologously expressed trehalose/maltose ABC transporter complex of the hyperthermophilic archaeon Thermococcus litoralis. Eur J Biochem, 268, 4011-4018. [PubMed: 11453995] Year of Identification 2001