| ProGlyProt ID | AU146 |
| Organism Information |
| Organism Name | Thermococcus litoralis DSM 5473 |
| Domain | Archaea |
| Classification | Family: Thermococcaceae
Order: Thermococcales
Class: Thermococci or Protoarchaea
Division or phylum: "Euryarchaeota" |
| Taxonomic ID (NCBI) | 2265 |
| Genome Sequence (s) |
| GeneBank | |
| EMBL | AF012836 |
| Gene Information |
| Gene Name | malE |
| NCBI Gene ID | |
| Protein Information |
| Protein Name | TMBP (Trehalose/maltose binding protein) |
| UniProtKB/SwissProt ID | Q7LYW7 |
| NCBI RefSeq | |
| EMBL-CDS | AAC38136.1 |
| UniProtKB Sequence | >tr|Q7LYW7|Q7LYW7_THELI Trehalose/maltose binding protein OS=Thermococcus litoralis GN=malE PE=4 SV=1
MNVKKVLLGLFLVGVLGIAVVASGCIGGQQTSTVTSTPTETSLQGKIVFAVGGAPNEIEY
WKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIAS
GWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYS
KPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKD
GKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYA
WGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYS
VQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKY
VNSALAGKISPQEALDKAQKEAEELVKQYS
|
| Sequence length | 450 AA |
| Subcellular Location | Membrane associated |
| Function | This soluble protein is involved in ABC transport of trehalose and maltose. It has got an exceptionally high substrate-binding affinity and transports the substrates at 85 deg C. |
| Glycosylation Status |
| Glycosylation Type | Information currently not available with us. |
| Technique(s) used for Glycosylation Detection | PAS-staining and ConA-Sepharose affinity chromatography. |
| Literatures |
| Reference(s) | 1) Greller, G., Riek, R. and Boos, W. (2001) Purification and characterization of the heterologously expressed trehalose/maltose ABC transporter complex of the hyperthermophilic archaeon Thermococcus litoralis. Eur J Biochem, 268, 4011-4018. [PubMed: 11453995] |
| Year of Identification | 2001 |
