ProGlyProt ID AU134 Organism Information Organism Name Pyrococcus furiosus DSM 3638 Domain Archaea Classification Family: Thermococcaceae Order: Thermococcales Class: Thermococci or Protoarchaea Division or phylum: "Euryarchaeota" Taxonomic ID (NCBI) 2261 Genome Sequence (s) GeneBank AE009950.1 EMBL AE009950 Gene Information Gene Name malE (PF1938) NCBI Gene ID 1469818 Protein Information Protein Name MDBP (Maltodextrin binding protein) UniProtKB/SwissProt ID P58300 NCBI RefSeq NP_579667.1 EMBL-CDS AAL82062.1 UniProtKB Sequence >sp|P58300|MALE_PYRFU Maltotriose-binding protein OS=Pyrococcus furiosus GN=malE PE=1 SV=1 MRRATYAFALLAILVLGVVASGCIGGGTTTPTQTSPATQPTTTQTPTQTETQAVECGSGK VVIWHAMQPNELEVFQSLAEEYMALCPEVEIVFEQKPNLEDALKAAIPTGQGPDLFIWAH DWIGKFAEAGLLEPIDEYVTEDLLNEFAPMAQDAMQYKGHYYALPFAAETVAIIYNKEMV SEPPKTFDEMKAIMEKYYDPANEKYGIAWPINAYFISAIAQAFGGYYFDDKTEQPGLDKP ETIEGFKFFFTEIWPYMAPTGDYNTQQSIFLEGRAPMMVNGPWSINDVKKAGINFGVVPL PPIIKDGKEYWPRPYGGVKLIYFAAGIKNKDAAWKFAKWLTTSEESIKTLALELGYIPVL TKVLDDPEIKNDPVIYGFGQAVQHAYLMPKSPKMSAVWGGVDGAINEILQDPQNADIEGI LKKYQQEILNNMQG Sequence length 434 AA Subcellular Location Membrane Function Binding protein-dependent ABC transporter mediating uptake of α-glucosides. It transports maltotriose and higher maltooligosaccharides, but not maltose. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection Concanavalin A (ConA) binding, Periodic acid- Schiff reagent (PAS) staining. Literatures Reference(s) 1) Koning, S.M., Konings, W.N. and Driessen, A.J. (2002) Biochemical evidence for the presence of two alpha-glucoside ABC-transport systems in the hyperthermophilic archaeon Pyrococcus furiosus. Archaea, 1, 19-25. [PubMed: 15803655] Year of Identification 2002