ProGlyProt ID AU133 Organism Information Organism Name Pyrococcus furiosus DSM 3638 Domain Archaea Classification Family: Thermococcaceae Order: Thermococcales Class: Thermococci or Protoarchaea Division or phylum: "Euryarchaeota" Taxonomic ID (NCBI) 2261 Genome Sequence (s) GeneBank AE009950.1 EMBL AE009950 Gene Information Gene Name malE (PF1739) NCBI Gene ID 1469617 Protein Information Protein Name TMBP (Trehalose/maltose binding protein) UniProtKB/SwissProt ID O51923 NCBI RefSeq NP_579468.1 EMBL-CDS AAL81863.1 UniProtKB Sequence >tr|O51923|O51923_PYRFU Trehalose/maltose binding protein OS=Pyrococcus furiosus GN=malE PE=1 SV=1 MNVKKVLLGLFLVGVLGIAVVASGCIGGQQTSTVTSTPTETSLQGKIVFAVGGAPNEIEY WKGVIAEFEKKYPGVTVELKRQATDTEQRRLDLVNALRGKSSDPDVFLMDVAWLGQFIAS GWLEPLDDYVQKDNYDLSVFFQSVINLADKQGGKLYALPVYIDAGLLYYRKDLLEKYGYS KPPETWQELVEMAQKIQSGERETNPNFWGFVWQGKQYEGLVCDFVEYVYSNGGSLGEFKD GKWVPTLNKPENVEALQFMVDLIHKYKISPPNTYTEMTEEPVRLMFQQGNAAFERNWPYA WGLHNADDSPVKGKVGVAPLPHFPGHKSAATLGGWHIGISKYSDNKALAWEFVKFVESYS VQKGFAMNLGWNPGRVDVYDDPAVVSKSPHLKELRAVFENAVPRPIVPYYPQLSEIIQKY VNSALAGKISPQEALDKAQKEAEELVKQYS Sequence length 450 AA Subcellular Location Membrane Function Binding protein-dependent ABC transporter mediating uptake of α-glucosides. It transports trehalose and maltose. Glycosylation Status Glycosylation Type N(Asn)- linked Technique(s) used for Glycosylation Detection Concanavalin A (ConA) binding, Periodic acid- Schiff reagent (PAS) staining. Literatures Reference(s) 1) Koning, S.M., Konings, W.N. and Driessen, A.J. (2002) Biochemical evidence for the presence of two alpha-glucoside ABC-transport systems in the hyperthermophilic archaeon Pyrococcus furiosus. Archaea, 1, 19-25. [PubMed: 15803655] Year of Identification 2002