| ProGlyProt ID | AU108 |
| Organism Information |
| Organism Name | Methanobacterium bryantii BKYH |
| Domain | Archaea |
| Classification | Family: Methanobacteriaceae
Order: Methanobacteriales
Class: Methanobacteria or Archaeobacteria
Division or phylum: "Euryarchaeota" |
| Taxonomic ID (NCBI) | 2161 |
| Genome Sequence (s) |
| GeneBank | |
| EMBL | U40213 |
| Gene Information |
| Gene Name | crx |
| NCBI Gene ID | |
| Protein Information |
| Protein Name | CRX (Copper response extracellular protein) |
| UniProtKB/SwissProt ID | Q48929 |
| NCBI RefSeq | |
| EMBL-CDS | AAA97868.1 |
| UniProtKB Sequence | >tr|Q48929|Q48929_METBR Copper response extracellular protein OS=Methanobacterium bryantii PE=4 SV=1
MVNIDKKIVIIVGIVILIAVVAGAFLVTGTASADNKVRVGYLPSTGDSLYFIAKEKGYFA
DEGLDVQLNEFQTGPDEINSLLADKLDVEAGGVGEPLNFINNGKDLEIIGGAMGGGSSVI
AKDNQTAQALRDKPKNYEGKTVATVKMSTPDVTIKAALKEQGVDLNKVNFVEFKTAADVV
QAVKSGKAQVGLVWPPFEYTAQQQGLIIVKYSDEYQPNHPCCRIVTTETKLKANPDKWVK
FERALIRAYDFYKNNPDETTAIVGKYVKMDQTTLKKALYNGHLSLVPDPNKKGTLAYWNF
LEQLGYSNITNTSALDKSIDTTVYKTALDQLAQQNPNNANYKFLEKQYIKLDQ
|
| Sequence length | 353 AA |
| Subcellular Location | Secreted |
| Function | The CRX proteins are secreted at higher levels by this methanogen in response to copper exposure. Likely to be involved in copper resistance, although they could be synthesized as part of a more generic stress response. N-terminal leader peptide, containing 28 AA, that is removed during extracellular secretion. |
| Glycosylation Status |
| Glycosylation Type | Information currently not available with us. |
| Technique(s) used for Glycosylation Detection | ConA binding and deglycosylation with neuraminidase. |
| Literatures |
| Reference(s) | 1) Kim, B.K., Pihl, T.D., Reeve, J.N. and Daniels, L. (1995) Purification of the copper response extracellular proteins secreted by the copper-resistant methanogen Methanobacterium bryantii BKYH and cloning, sequencing, and transcription of the gene encoding these proteins. J Bacteriol, 177, 7178-7185. [PubMed: 8522526] |
| Year of Identification | 1995 |
