ProGlyProt ID AU108 Organism Information Organism Name Methanobacterium bryantii BKYH Domain Archaea Classification Family: Methanobacteriaceae Order: Methanobacteriales Class: Methanobacteria or Archaeobacteria Division or phylum: "Euryarchaeota" Taxonomic ID (NCBI) 2161 Genome Sequence (s) GeneBank EMBL U40213 Gene Information Gene Name crx NCBI Gene ID Protein Information Protein Name CRX (Copper response extracellular protein) UniProtKB/SwissProt ID Q48929 NCBI RefSeq EMBL-CDS AAA97868.1 UniProtKB Sequence >tr|Q48929|Q48929_METBR Copper response extracellular protein OS=Methanobacterium bryantii PE=4 SV=1 MVNIDKKIVIIVGIVILIAVVAGAFLVTGTASADNKVRVGYLPSTGDSLYFIAKEKGYFA DEGLDVQLNEFQTGPDEINSLLADKLDVEAGGVGEPLNFINNGKDLEIIGGAMGGGSSVI AKDNQTAQALRDKPKNYEGKTVATVKMSTPDVTIKAALKEQGVDLNKVNFVEFKTAADVV QAVKSGKAQVGLVWPPFEYTAQQQGLIIVKYSDEYQPNHPCCRIVTTETKLKANPDKWVK FERALIRAYDFYKNNPDETTAIVGKYVKMDQTTLKKALYNGHLSLVPDPNKKGTLAYWNF LEQLGYSNITNTSALDKSIDTTVYKTALDQLAQQNPNNANYKFLEKQYIKLDQ Sequence length 353 AA Subcellular Location Secreted Function The CRX proteins are secreted at higher levels by this methanogen in response to copper exposure. Likely to be involved in copper resistance, although they could be synthesized as part of a more generic stress response. N-terminal leader peptide, containing 28 AA, that is removed during extracellular secretion. Glycosylation Status Glycosylation Type Information currently not available with us. Technique(s) used for Glycosylation Detection ConA binding and deglycosylation with neuraminidase. Literatures Reference(s) 1) Kim, B.K., Pihl, T.D., Reeve, J.N. and Daniels, L. (1995) Purification of the copper response extracellular proteins secreted by the copper-resistant methanogen Methanobacterium bryantii BKYH and cloning, sequencing, and transcription of the gene encoding these proteins. J Bacteriol, 177, 7178-7185. [PubMed: 8522526] Year of Identification 1995