ProGlyProt ID BC171 Organism Information Organism Name Pseudomonas syringae pv. glycinea race 4 Domain Bacteria Classification Family: Pseudomonadaceae Order: Pseudomonadales Class: Gammaproteobacteria Division or phylum: "Proteobacteria" Taxonomic ID (NCBI) 318 Genome Sequence (s) EMBL AB061232 Gene Information Gene Name fliC NCBI Gene ID Protein Information Protein Name Flagellin UniProtKB/SwissProt ID Q76M64 NCBI RefSeq EMBL-CDS BAD06420.1 UniProtKB Sequence >tr|Q76M64|Q76M64_PSESG Flagellin OS=Pseudomonas syringae pv. glycinea GN=fliC PE=4 SV=1 MALTVNTNAASLNVQKNLGRASDALSTSMTRLSSGLKINSAKDDAAGLQIATKITSQIRG QTMAIKNANDGMSLAQTAEGALQESTNILQRMRELAVQSRNDSNSSTDRDALNKEFTAMS SELTRIAQSTNLNGKNLLDGSASTMTFQVGSNSGASNQITLTLSASFDANTLGVGSAVTI AGSDSTTAETNFSAAIAAIDSALQTINSTRADLGAAQNRLTSTISNLQNINENASAALGR VQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLQ Sequence length 282 AA Subcellular Location Surface Function Flagellin, the major component of the flagella filament functions as one of the pathogen-associated molecular patterns (PAMPs). It is able to induce hypersensitive cell death in its non-host tobacco plants. Protein Structure PDB ID Glycosylation Status Glycosylation Type O (Ser) linked Experimentally Validated Glycosite(s) in Full Length Protein S143, S164, S176, S183, S193, S201 Experimentally Validated Glycosite(s ) in Mature Protein S143, S164, S176, S183, S193, S201 Glycosite(s) Annotated Protein Sequence >tr|Q76M64|Q76M64_PSESG Flagellin OS=Pseudomonas syringae pv. glycinea GN=fliC PE=4 SV=1 MALTVNTNAASLNVQKNLGRASDALSTSMTRLSSGLKINSAKDDAAGLQIATKITSQIRG QTMAIKNANDGMSLAQTAEGALQESTNILQRMRELAVQSRNDSNSSTDRDALNKEFTAMS SELTRIAQSTNLNGKNLLDGSAS*(143)TMTFQVGSNSGASNQITLTLS*(164)ASFDANTLGVGS*(176)AVTI AGS*(183)DSTTAETNFS*(193)AAIAAIDS*(201)ALQTINSTRADLGAAQNRLTSTISNLQNINENASAALGR VQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLQ Sequence Around Glycosites (21 AA) NGKNLLDGSASTMTFQVGSNS GASNQITLTLSASFDANTLGV SFDANTLGVGSAVTIAGSDST GVGSAVTIAGSDSTTAETNFS SDSTTAETNFSAAIAAIDSAL NFSAAIAAIDSALQTINSTRA Glycosite Sequence Logo seqlogo Glycosite Sequence Logo Technique(s) used for Glycosylation Detection Rapid migration on SDS-PAGE after chemical deglycosylation with TFMS, glycoprotein staining using GelCode® glycoprotein staining kit. Technique(s) used for Glycosylated Residue(s) Detection Site-directed mutagenesis and MALDI-TOF MS (matrix assisted laser desorption/ionization time of flight mass spectrometry) analysis Protein Glycosylation- Implication The flagellin glycan structures have a role to play in the virulence and host specificity of P. syringae. Glycosylation is important for the HR-inducing (hypersensitive reaction, a rapid and strong plant defence response) ability of the flagellin in plants. Glycan Information Glycan Annotation Linkage: Rha-Ser. S201 carries a unique trisaccharide consisting of two rhamnosyl (Rha) residues and one modified 4-amino-4,6-dideoxyglucosyl (Qui4N; named as viosamine) residue, ß-D-Quip4N(3-hydroxy-1-oxobutyl)2Me-(1→3)-α-L-Rhap-(1→2)-α-L-Rhap. The trisaccharide is present as the major glycan on each Ser residue. The glycans contain both L-Rha and D-Rha at a molar ratio of about 4:1. Heterogeneity due to the addition of one or two units of mass value 147 is also observed. Technique(s) used for Glycan Identification Sugar composition analysis using an ABEE (p-aminobenzoic acid ethyl ester) labeling kit, MALDI-TOF MS (matrix-assisted laser desorption ionization–time-of-flight mass spectrometry), determination of D-Rha/L-Rha ratios using gas chromatography (GC), and 1H-NMR analyses including 1H-1H correlation spectra [DQF-COSY (double quantum filtered correlation spectroscopy), TOCSY (total correlation spectroscopy), and NOESY (nuclear Overhauser and exchange spectroscopy)] and 1H-13C correlation spectra [H Protein Glycosylation linked (PGL) gene(s) OST Gene Name OST NCBI Gene ID OST GenBank Gene Sequence OST Protein Name OST UniProtKB/ SwissProt ID OST NCBI RefSeq OST EMBL-CDS OST UniProtKB Sequence OST EC Number (BRENDA) OST Genome Context Characterized Accessory Gene(s) Orf1 and Orf2 are putative glycosyltransferases encoded in the flagellin glycosylation island. PGL Additional Links CAZy Literatures Reference(s) 1) Takeuchi, K., Ono, H., Yoshida, M., Ishii, T., Katoh, E., Taguchi, F., Miki, R., Murata, K., Kaku, H. and Ichinose, Y. (2007) Flagellin glycans from two pathovars of Pseudomonas syringae contain rhamnose in D and L configurations in different ratios and modified 4-amino-4,6-dideoxyglucose. J Bacteriol, 189, 6945-6956. [PubMed: 17644592] 2) Taguchi, F., Takeuchi, K., Katoh, E., Murata, K., Suzuki, T., Marutani, M., Kawasaki, T., Eguchi, M., Katoh, S., Kaku, H. et al. (2006) Identification Additional Comments Year of Identification 2003 Year of Validation 2006