ProGlyProt ID BC169 Organism Information Organism Name Pseudomonas aeruginosa PAO1 Domain Bacteria Classification Family: Pseudomonadaceae Order: Pseudomonadales Class: Gammaproteobacteria Division or phylum: "Proteobacteria" Taxonomic ID (NCBI) 287 Genome Sequence (s) GeneBank AE004091.2 EMBL AE004091 Gene Information Gene Name lecB (PA3361) NCBI Gene ID 882528 GenBank Gene Sequence 882528 Protein Information Protein Name Lectin LecB (PA-IIL is old name) UniProtKB/SwissProt ID Q9HYN5 NCBI RefSeq NP_252051.1 EMBL-CDS AAG06749.1 UniProtKB Sequence >tr|Q9HYN5|Q9HYN5_PSEAE Fucose-binding lectin PA-IIL OS=Pseudomonas aeruginosa GN=lecB PE=1 SV=1 MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGS SGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG Sequence length 115 AA Subcellular Location Periplasm or outer membrane Function LecB is a fucose-/mannose-specific lectin. It may help in the adhesion of P. aeruginosa cells to the receptors and facilitate biofilm formation resulting in host tissue colonization. This virulence factor has an important role in human infection. It inhibits the ciliary beating and hence defence mechanism of the lung. It is involved in cystic fibrosis. Protein Structure PDB ID Glycosylation Status Glycosylation Type N (Asn) linked Experimentally Validated Glycosite(s) in Full Length Protein N22 Experimentally Validated Glycosite(s ) in Mature Protein N22 Glycosite(s) Annotated Protein Sequence >tr|Q9HYN5|Q9HYN5_PSEAE Fucose-binding lectin PA-IIL OS=Pseudomonas aeruginosa GN=lecB PE=1 SV=1 MATQGVFTLPANTRFGVTAFAN*(22)SSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGS SGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG Sequence Around Glycosites (21 AA) NTRFGVTAFANSSGTQTVNVL Glycosite Sequence Logo seqlogo Glycosite Sequence Logo Technique(s) used for Glycosylation Detection Deglycosylation with N-glycosidase F (PNGase F) Technique(s) used for Glycosylated Residue(s) Detection Site-directed mutagenesis (N22A) Protein Glycosylation- Implication LecB N glycosylation seems to be important for its production and transport to the outer membrane. Glycan Information Glycan Annotation Technique(s) used for Glycan Identification Protein Glycosylation linked (PGL) gene(s) OST Gene Name OST NCBI Gene ID OST GenBank Gene Sequence OST Protein Name OST UniProtKB/ SwissProt ID OST NCBI RefSeq OST EMBL-CDS OST UniProtKB Sequence OST EC Number (BRENDA) OST Genome Context Characterized Accessory Gene(s) PGL Additional Links CAZy Literatures Reference(s) 1) Bartels, K.M., Funken, H., Knapp, A., Brocker, M., Bott, M., Wilhelm, S., Jaeger, K.E. and Rosenau, F. (2011) Glycosylation is required for outer membrane localization of the lectin LecB in Pseudomonas aeruginosa. J Bacteriol, 193, 1107-1113. [PubMed: 21217000] Additional Comments A LecB-deficient P. aeruginosa strain has been shown to be impaired in biofilm formation. Year of Identification 2011 Year of Validation 2011