| ProGlyProt ID | BC161 |
| Organism Information |
| Organism Name | Pedobacter heparinus (Flavobacterium heparinum) |
| Domain | Bacteria |
| Classification | Family: Sphingobacteriaceae
Order: "Sphingobacteriales"
Class: "Sphingobacteria"
Division or phylum: "Bacteroidetes" |
| Taxonomic ID (NCBI) | 984 |
| Genome Sequence (s) |
| GeneBank | CP001681.1 |
| EMBL | L12534 |
| Gene Information |
| Gene Name | hep A |
| NCBI Gene ID | 8251559 |
| GenBank Gene Sequence | 8251559 |
| Protein Information |
| Protein Name | Heparin lyase I or Heparinase I
|
| UniProtKB/SwissProt ID | Q05819 |
| NCBI RefSeq | YP_003090758.1 |
| EMBL-CDS | AAA24920.1 |
| UniProtKB Sequence | >sp|Q05819|HEP1_PEDHE Heparin lyase I OS=Pedobacter heparinus PE=1 SV=1
MKKQILYLIVLQQLFLCSAYAQQKKSGNIPYRVNVQADSAKQKAIIDNKWVAVGINKPYA
LQYDDKLRFNGKPSYRFELKAEDNSLEGYAAGETKGRTELSYSYATTNDFKKFPPSVYQN
AQKLKTVYHYGKGICEQGSSRSYTFSVYIPSSFPDNATTIFAQWHGAPSRTLVATPEGEI
KTLSIEEFLALYDRMIFKKNIAHDKVEKKDKDGKITYVAGKPNGWKVEQGGYPTLAFGFS
KGYFYIKANSDRQWLTDKADRNNANPENSEVMKPYSSEYKTSTIAYKMPFAQFPKDCWIT
FDVAIDWTKYGKEANTILKPGKLDVMMTYTKNKKPQKAHIVNQQEILIGRNDDDGYYFKF
GIYRVGNSTVPVTYNLSGYSETAR
|
| Sequence length | 384 AA |
| Subcellular Location | Periplasm |
| Function | GAG lyase. EC= 4.2.2.7. It has been assigned to the polysaccharide lyase family PL13. Degrades heparin and heparan sulfate. Also implicated in the release of heparin-bound growth factors from the extracellular matrix.
|
| Protein Structure |
| PDB ID | |
| Glycosylation Status |
| Glycosylation Type | O (Ser) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | S39 |
| Experimentally Validated Glycosite(s ) in Mature Protein | S39 |
| Glycosite(s) Annotated Protein Sequence | >sp|Q05819|HEP1_PEDHE Heparin lyase I OS=Pedobacter heparinus PE=1 SV=1
MKKQILYLIVLQQLFLCSAYAQQKKSGNIPYRVNVQADS*(39)AKQKAIIDNKWVAVGINKPYA
LQYDDKLRFNGKPSYRFELKAEDNSLEGYAAGETKGRTELSYSYATTNDFKKFPPSVYQN
AQKLKTVYHYGKGICEQGSSRSYTFSVYIPSSFPDNATTIFAQWHGAPSRTLVATPEGEI
KTLSIEEFLALYDRMIFKKNIAHDKVEKKDKDGKITYVAGKPNGWKVEQGGYPTLAFGFS
KGYFYIKANSDRQWLTDKADRNNANPENSEVMKPYSSEYKTSTIAYKMPFAQFPKDCWIT
FDVAIDWTKYGKEANTILKPGKLDVMMTYTKNKKPQKAHIVNQQEILIGRNDDDGYYFKF
GIYRVGNSTVPVTYNLSGYSETAR
|
| Sequence Around Glycosites (21 AA) | IPYRVNVQADSAKQKAIIDNK |
| Glycosite Sequence Logo | seqlogo |
| Glycosite Sequence Logo |  |
| Technique(s) used for Glycosylation Detection | Presence of multiple isoforms in the RPHPLC (reverse-phase high pressure liquid chromatography) profile, and mass excess (approx. 1.1 kDa) detected using mass spectrometry. |
| Technique(s) used for Glycosylated Residue(s) Detection | NMR and mass spectrometry |
| Protein Glycosylation- Implication | |
| Glycan Information |
| Glycan Annotation | Linkage: Man-Ser.
Branched heptasaccharide is: galactose-β(1–4)[galactose-α(1–3)](2-O-Me)fucose-β(1–4)xylose-β (1–4)glucuronic acid-α(1–2)[rhamnose-α(1–4)]mannose-α(1-O)Ser. |
| Technique(s) used for Glycan Identification | Combination of enzymatic digestion, NMR and mass spectroscopy. |
| Protein Glycosylation linked (PGL) gene(s) |
| OST Gene Name | |
| OST NCBI Gene ID | |
| OST GenBank Gene Sequence | |
| OST Protein Name | |
| OST UniProtKB/ SwissProt ID | |
| OST NCBI RefSeq | |
| OST EMBL-CDS | |
| OST UniProtKB Sequence | |
| OST EC Number (BRENDA) | |
| OST Genome Context | |
| Characterized Accessory Gene(s) | Information currently not available with us. |
| PGL Additional Links | CAZy |
| Literatures |
| Reference(s) | 1) Shaya, D., Tocilj, A., Li, Y., Myette, J., Venkataraman, G., Sasisekharan, R. and Cygler, M. (2006) Crystal structure of heparinase II from Pedobacter heparinus and its complex with a disaccharide product. J Biol Chem, 281, 15525-15535. [PubMed: 16565082]
2) Godavarti, R. and Sasisekharan, R. (1996) A comparative analysis of the primary sequences and characteristics of heparinases I, II, and III from Flavobacterium heparinum. Biochem Biophys Res Commun, 229, 770-777. [PubMed: 8954971] |
| Additional Comments | Sequon features: Asp-Ser consensus sequon is found in this protein.
Post translational modification was detected as early as 1993 but the glycosylation was confirmed in 1995. |
| Year of Identification | 1995 |
| Year of Validation | 1995 |
