ProGlyProt ID BC161 Organism Information Organism Name Pedobacter heparinus (Flavobacterium heparinum) Domain Bacteria Classification Family: Sphingobacteriaceae Order: "Sphingobacteriales" Class: "Sphingobacteria" Division or phylum: "Bacteroidetes" Taxonomic ID (NCBI) 984 Genome Sequence (s) GeneBank CP001681.1 EMBL L12534 Gene Information Gene Name hep A NCBI Gene ID 8251559 GenBank Gene Sequence 8251559 Protein Information Protein Name Heparin lyase I or Heparinase I UniProtKB/SwissProt ID Q05819 NCBI RefSeq YP_003090758.1 EMBL-CDS AAA24920.1 UniProtKB Sequence >sp|Q05819|HEP1_PEDHE Heparin lyase I OS=Pedobacter heparinus PE=1 SV=1 MKKQILYLIVLQQLFLCSAYAQQKKSGNIPYRVNVQADSAKQKAIIDNKWVAVGINKPYA LQYDDKLRFNGKPSYRFELKAEDNSLEGYAAGETKGRTELSYSYATTNDFKKFPPSVYQN AQKLKTVYHYGKGICEQGSSRSYTFSVYIPSSFPDNATTIFAQWHGAPSRTLVATPEGEI KTLSIEEFLALYDRMIFKKNIAHDKVEKKDKDGKITYVAGKPNGWKVEQGGYPTLAFGFS KGYFYIKANSDRQWLTDKADRNNANPENSEVMKPYSSEYKTSTIAYKMPFAQFPKDCWIT FDVAIDWTKYGKEANTILKPGKLDVMMTYTKNKKPQKAHIVNQQEILIGRNDDDGYYFKF GIYRVGNSTVPVTYNLSGYSETAR Sequence length 384 AA Subcellular Location Periplasm Function GAG lyase. EC= 4.2.2.7. It has been assigned to the polysaccharide lyase family PL13. Degrades heparin and heparan sulfate. Also implicated in the release of heparin-bound growth factors from the extracellular matrix. Protein Structure PDB ID Glycosylation Status Glycosylation Type O (Ser) linked Experimentally Validated Glycosite(s) in Full Length Protein S39 Experimentally Validated Glycosite(s ) in Mature Protein S39 Glycosite(s) Annotated Protein Sequence >sp|Q05819|HEP1_PEDHE Heparin lyase I OS=Pedobacter heparinus PE=1 SV=1 MKKQILYLIVLQQLFLCSAYAQQKKSGNIPYRVNVQADS*(39)AKQKAIIDNKWVAVGINKPYA LQYDDKLRFNGKPSYRFELKAEDNSLEGYAAGETKGRTELSYSYATTNDFKKFPPSVYQN AQKLKTVYHYGKGICEQGSSRSYTFSVYIPSSFPDNATTIFAQWHGAPSRTLVATPEGEI KTLSIEEFLALYDRMIFKKNIAHDKVEKKDKDGKITYVAGKPNGWKVEQGGYPTLAFGFS KGYFYIKANSDRQWLTDKADRNNANPENSEVMKPYSSEYKTSTIAYKMPFAQFPKDCWIT FDVAIDWTKYGKEANTILKPGKLDVMMTYTKNKKPQKAHIVNQQEILIGRNDDDGYYFKF GIYRVGNSTVPVTYNLSGYSETAR Sequence Around Glycosites (21 AA) IPYRVNVQADSAKQKAIIDNK Glycosite Sequence Logo seqlogo Glycosite Sequence Logo Technique(s) used for Glycosylation Detection Presence of multiple isoforms in the RPHPLC (reverse-phase high pressure liquid chromatography) profile, and mass excess (approx. 1.1 kDa) detected using mass spectrometry. Technique(s) used for Glycosylated Residue(s) Detection NMR and mass spectrometry Protein Glycosylation- Implication Glycan Information Glycan Annotation Linkage: Man-Ser. Branched heptasaccharide is: galactose-β(1–4)[galactose-α(1–3)](2-O-Me)fucose-β(1–4)xylose-β (1–4)glucuronic acid-α(1–2)[rhamnose-α(1–4)]mannose-α(1-O)Ser. Technique(s) used for Glycan Identification Combination of enzymatic digestion, NMR and mass spectroscopy. Protein Glycosylation linked (PGL) gene(s) OST Gene Name OST NCBI Gene ID OST GenBank Gene Sequence OST Protein Name OST UniProtKB/ SwissProt ID OST NCBI RefSeq OST EMBL-CDS OST UniProtKB Sequence OST EC Number (BRENDA) OST Genome Context Characterized Accessory Gene(s) Information currently not available with us. PGL Additional Links CAZy Literatures Reference(s) 1) Shaya, D., Tocilj, A., Li, Y., Myette, J., Venkataraman, G., Sasisekharan, R. and Cygler, M. (2006) Crystal structure of heparinase II from Pedobacter heparinus and its complex with a disaccharide product. J Biol Chem, 281, 15525-15535. [PubMed: 16565082] 2) Godavarti, R. and Sasisekharan, R. (1996) A comparative analysis of the primary sequences and characteristics of heparinases I, II, and III from Flavobacterium heparinum. Biochem Biophys Res Commun, 229, 770-777. [PubMed: 8954971] Additional Comments Sequon features: Asp-Ser consensus sequon is found in this protein. Post translational modification was detected as early as 1993 but the glycosylation was confirmed in 1995. Year of Identification 1995 Year of Validation 1995