ProGlyProt ID BC159 Organism Information Organism Name Neisseria meningitidis serogroup B strain C311#3/ MC58 Domain Bacteria Classification Family: Neisseriaceae Order: Neisseriales Class: Betaproteobacteria Division or phylum: "Proteobacteria" Taxonomic ID (NCBI) 491 Genome Sequence (s) GeneBank AE002098.2 EMBL AE002098 Gene Information Gene Name pilE (NMB0018) NCBI Gene ID 902121 GenBank Gene Sequence 902121 Protein Information Protein Name PilE (pilin) UniProtKB/SwissProt ID P05431 NCBI RefSeq NP_273084.1 EMBL-CDS AAF40497.1 UniProtKB Sequence >sp|P05431|FMM1_NEIMB Fimbrial protein OS=Neisseria meningitidis serogroup B GN=pilE PE=1 SV=2 MNTLQKGFTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLN HGEWPGNNTSAGVATSSEIKGKYVKSVEVKNGVVTAQMASSNVNNEIKGKKLSLWAKRQN GSVKWFCGQPVTRDKAKAANDDVTAAAAANGKKIDTKHLPSTCRDASDAS Sequence length 170 AA Subcellular Location Surface Function Major structural subunit of class 1 pili. Crucial role in both colonization of the host and adhesion to host cells. Protein Structure PDB ID Glycosylation Status Glycosylation Type O (Ser) linked Experimentally Validated Glycosite(s) in Full Length Protein (Propeptide: 1-7) S70 Experimentally Validated Glycosite(s ) in Mature Protein S63 Glycosite(s) Annotated Protein Sequence >sp|P05431|FMM1_NEIMB Fimbrial protein OS=Neisseria meningitidis serogroup B GN=pilE PE=1 SV=2 MNTLQKGFTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLN HGEWPGNNTS*(70)AGVATSSEIKGKYVKSVEVKNGVVTAQMASSNVNNEIKGKKLSLWAKRQN GSVKWFCGQPVTRDKAKAANDDVTAAAAANGKKIDTKHLPSTCRDASDAS Sequence Around Glycosites (21 AA) NHGEWPGNNTSAGVATSSEIK Glycosite Sequence Logo seqlogo Glycosite Sequence Logo Technique(s) used for Glycosylation Detection Rapid migration after deglycosylation, mass shift detected on SDS-polyacrylamide gel and biotin-hydrazide labelling Technique(s) used for Glycosylated Residue(s) Detection Gas-phase Edman sequencing and site-directed mutagenesis (S63A) Protein Glycosylation- Implication 5NβOHC47NfmPse has the same basic structure common to the sialic acid family of sugars, which have been postulated to function as biological masks protecting sensitive protein structures. Therefore, the presence of the pilin glycan may protect the pili from complement binding and phagocytosis or protect potential epitopes from the host B-cell response. Further, the glycosylation helps in the solubilization of the pilin monomers and/or individual pilus fibres (of strain 8013). Glycan Information Glycan Annotation Linkage: DATDH-Ser. Unusual trisaccharide molecule, Gal(β1-4)Gal(α1-3)2,4-diacetimido-2,4,6-trideoxyhexose [Gal(β1-4)Gal(α1-3)DATDH]. In N. meningitidis 8013 strain, 2-glyceramido 4-acetamido 2,4,6-trideoxyhexose (GATDH) has been found in place of DATDH. Technique(s) used for Glycan Identification GC-MS of alditol acetates obtained by trifluoro acetic acid (TFA) hydrolysis of permethylated HPLC fractions, and GC-MS after trimethylsilyl ether derivatization of oligosaccharides reductively eliminated from the peptide. Protein Glycosylation linked (PGL) gene(s) OST Gene Name pglL OST NCBI Gene ID 903280 OST GenBank Gene Sequence 903280 OST Protein Name PglL OST UniProtKB/ SwissProt ID Q7DD76 OST NCBI RefSeq NP_274817.1 OST EMBL-CDS AAF42155.1 OST UniProtKB Sequence >tr|Q7DD76|Q7DD76_NEIMB Pilin glycosylation protein PglB OS=Neisseria meningitidis serogroup B GN=pglB PE=4 SV=1 MSKFFKRLFDIVASASGLIFLSPVFLILIYLIRKNLGSPVFFFQERPGKDGKPFKMVKFR SMRDALDSDGIPLPDGERLTPFGKKLRAASLDELPELWNILKGEMSLVGPRPLLMQYLPL YDNFQNRRHEMKPGITGWAQVNGRNALSWDEKFACDVWYIDHFSLCLDIKILLLTVKKVL IKEGISAQGEATMPPFTGKRKLAVVGAGGHGKVVADLAAALGRYREIVFLDDRAQGSVNG FSVIGTTLLLENSLSPEQYDVAVAVGNNRIRRQIAEKAAALGFALPVLVHPDATVSPSAT VGQGSVVMAKAVVQAGSVLKDGVIVNTAATVDHDCLLNAFVHISPGAHLSGNTHIGEESW IGTGACSRQQIRIGSRATIGAGAVVVRDVSDGMTVAGNPAKPLPRKNPETSTA OST EC Number (BRENDA) 2.4.1.119 OST Genome Context Q7DD76 Characterized Accessory Gene(s) PglA, PglB2, PglE. Galactosyltransferase PglA transfers the galactose to DATDH. PglE catalyzes the attachment of the terminal galactose to the glycan. PglBCD enzymes are essential for biosynthesis of DATDH from GlcNAc. PglB (B1) also catalyzes transfer of DATDH onto the lipid carrier. PglF is the flippase. PglB2 is a glyceramido transferase that synthesizes GATDH and transfers it onto the lipid carrier. PGL Additional Links CAZy Literatures Reference(s) 1) Chamot-Rooke, J., Rousseau, B., Lanternier, F., Mikaty, G., Mairey, E., Malosse, C., Bouchoux, G., Pelicic, V., Camoin, L., Nassif, X. et al. (2007) Alternative Neisseria spp. type IV pilin glycosylation with a glyceramido acetamido trideoxyhexose residue. Proc Natl Acad Sci U S A, 104, 14783-14788. [PubMed: 17804791] 2) Power, P.M., Seib, K.L. and Jennings, M.P. (2006) Pilin glycosylation in Neisseria meningitidis occurs by a similar pathway to wzy-dependent O-antigen biosynthesis in Es Additional Comments MS11 strain containing the pglB2 allele from the 8013 strain expresses a pilin modified with a GATDH (2-acetamido 4-glyceramido 2,4,6-trideoxyhexose). Sequone feature: S/T plus low complexity region, the glycan modifications are found on a flexible-loop region within the globular domain of the protein. Year of Identification 1993 Year of Validation 1998