ProGlyProt ID BC154 Organism Information Organism Name Mycobacterium tuberculosis H37Rv Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1773 Genome Sequence (s) GeneBank BX842573.1 EMBL BX842573 Gene Information Gene Name sodC (Rv0432) NCBI Gene ID 886358 GenBank Gene Sequence 886358 Protein Information Protein Name Superoxide dismutase [Cu-Zn] UniProtKB/SwissProt ID P0A608 NCBI RefSeq NP_214946.1 EMBL-CDS CAB06572.1 UniProtKB Sequence >sp|P0A608|SODC_MYCTU Superoxide dismutase [Cu-Zn] OS=Mycobacterium tuberculosis GN=sodC PE=1 SV=1 MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGTTPSIWTGSPAPSGLS GHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTGVGKLTPGFHGLHIHQV GKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQVRGDGSAMLVTTTDAFT MDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG Sequence length 240 AA Subcellular Location Associated with cell envelope (or membrane) Function One of two Mtb superoxide dismutases (SODs) and is a membrane-associated lipoprotein of the Cu, Zn-dependent SOD family. Contributes to the survival of Mtb in activated macrophages, suggesting a role in the defense against the oxidative burst produced in vivo. EC= 1.15.1.1 Protein Structure PDB ID 1PZS Glycosylation Status Glycosylation Type O (Ser/Thr) linked Experimentally Validated Glycosite(s) in Full Length Protein T45, T46, S48, T51, S53, S57 Experimentally Validated Glycosite(s ) in Mature Protein T45, T46, S48, T51, S53, S57 Glycosite(s) Annotated Protein Sequence >sp|P0A608|SODC_MYCTU Superoxide dismutase [Cu-Zn] OS=Mycobacterium tuberculosis GN=sodC PE=1 SV=1 MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGT*(45)T*(46)PS*(48)IWT*(51)GS*(53)PAPS*(57)GLS GHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTGVGKLTPGFHGLHIHQV GKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQVRGDGSAMLVTTTDAFT MDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG Sequence Around Glycosites (21 AA) SPQHASTVPGTTPSIWTGSPA PQHASTVPGTTPSIWTGSPAP HASTVPGTTPSIWTGSPAPSG TVPGTTPSIWTGSPAPSGLSG PGTTPSIWTGSPAPSGLSGHD PSIWTGSPAPSGLSGHDEESP Glycosite Sequence Logo seqlogo Glycosite Sequence Logo Technique(s) used for Glycosylation Detection Concanavalin A (ConA)-binding Technique(s) used for Glycosylated Residue(s) Detection LC-ESI-MS/MS (liquid chromatography-electrospray-ionization-tandem mass spectrometry) and site-directed mutagenesis (Thr to Ala) Protein Glycosylation- Implication Glycosylation of this enzyme modulates proteolytic cleavage within the unstructured SodC N-terminus and influences SodC localization and stability. Glycan Information Glycan Annotation Linkages: αMan-Thr/Ser. Variable modifications with one to three hexose (mannose) units on each site. The total number of hexose units present is in the range of 6-10. The most dominant SodC glycoform was modified with nine hexose units. Technique(s) used for Glycan Identification ESI-MS/MS (electrospray ionization tandem mass spctrometry) Protein Glycosylation linked (PGL) gene(s) OST Gene Name pmt/rv1002c OST NCBI Gene ID 887882 OST GenBank Gene Sequence 887882 OST Protein Name Protein O mannosyltransferase OST UniProtKB/ SwissProt ID O05586 OST NCBI RefSeq NP_215518.1 OST EMBL-CDS CAB08157.1 OST UniProtKB Sequence >sp|O05586|Y1002_MYCTU Uncharacterized protein Rv1002c/MT1031 OS=Mycobacterium tuberculosis GN=Rv1002c PE=3 SV=2 MVPVVSPGPLVPVADFGPLDRLRGWIVTGLITLLATVTRFLNLGSLTDAGTPIFDEKHYA PQAWQVLNNHGVEDNPGYGLVVHPPVGKQLIAIGEAIFGYNGFGWRFTGALLGVVLVALV VRIVRRISRSTLVGAIAGVLLICDGVSFVTARTALLDGFLTFFVVAAFGALIVDRDQVRE RMHIALLAGRSAATVWGPRVGVRWWRFGAGVLLGLACATKWSGVYFVLFFGAMALAFDVA ARRQYQVQRPWLGTVRRDVLPSGYALGLIPFAVYLATYAPWFASETAIDRHAVGQAVGRN SVVPLPDAVRSLWHYTAKAFHFHAGLTNSAGNYHPWESKPWTWPMSLRPVLYAIDQQDVA GCGAQSCVKAEMLVGTPAMWWLAVPVLAYAGWRMFVRRDWRYAVVLVGYCAGWLPWFADI DRQMYFFYAATMAPFLVMGISLVLGDILYHPGQGSERRTLGLIVVCCYVALVVTNFAWLY PVLTGLPISQQTWNLEIWLPSWR OST EC Number (BRENDA) 2.4.1.109 OST Genome Context O05586 Characterized Accessory Gene(s) Polyprenol-phosphate-mannose (PPM) synthase, Ppm1, is present. A second type of Ppm synthase (Rv3779 gene product) exclusive to slow-growing mycobacteria, is a membrane glycosyltransferase. It mannosylates polyprenyl-phosphates directly from GDP-mannose. PGL Additional Links CAZy Literatures Reference(s) 1) Sartain, M.J. and Belisle, J.T. (2009) N-Terminal clustering of the O-glycosylation sites in the Mycobacterium tuberculosis lipoprotein SodC. Glycobiology, 19, 38-51. [PubMed: 18842962] 2) Scherman, H., Kaur, D., Pham, H., Skovierova, H., Jackson, M. and Brennan, P.J. (2009) Identification of a polyprenylphosphomannosyl synthase involved in the synthesis of mycobacterial mannosides. J Bacteriol, 191, 6769-6772. [PubMed: 19717608] 3) Spagnolo, L., Toro, I., D'Orazio, M., O'Neill, P., Additional Comments Sec-mediated translocation influences the O-mannosylation. Ppm1 does not discriminate between polyprenol substrates with variable chain lengths and saturation of the isoprene units. Year of Identification 2000 Year of Validation 2009