| ProGlyProt ID | BC152 |
| Organism Information |
| Organism Name | Mycobacterium bovis AN5 |
| Domain | Bacteria |
| Classification | Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria" |
| Taxonomic ID (NCBI) | 1765 |
| Genome Sequence (s) |
| GeneBank | BX248344.1 |
| EMBL | BX248344 |
| Gene Information |
| Gene Name | mpb83 (Mb2898) |
| NCBI Gene ID | 1092210 |
| GenBank Gene Sequence | 1092210 |
| Protein Information |
| Protein Name | Cell surface lipoprotein MPB83 (25/23-kDa antigen |
| UniProtKB/SwissProt ID | P0CAX7 |
| NCBI RefSeq | NP_856543.1 |
| EMBL-CDS | CAD96585.1 |
| UniProtKB Sequence | >sp|P0CAX7|MP83_MYCBO Cell surface lipoprotein MPB83 OS=Mycobacterium bovis GN=mpb83 PE=4 SV=1
MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLI
GRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGG
EYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADL
TVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ
|
| Sequence length | 220 AA |
| Subcellular Location | Surface (membrane associated) |
| Function | Major immunodominant antigen. |
| Protein Structure |
| PDB ID | |
| Glycosylation Status |
| Glycosylation Type | O (Thr) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | T48, T49 |
| Experimentally Validated Glycosite(s ) in Mature Protein | T48, T49 |
| Glycosite(s) Annotated Protein Sequence | >sp|P0CAX7|MP83_MYCBO Cell surface lipoprotein MPB83 OS=Mycobacterium bovis GN=mpb83 PE=4 SV=1
MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVT*(48)T*(49)AAMADPAADLI
GRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGG
EYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADL
TVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ
|
| Sequence Around Glycosites (21 AA) | KPATSPAAPVTTAAMADPAAD
PATSPAAPVTTAAMADPAADL
|
| Glycosite Sequence Logo | seqlogo |
| Glycosite Sequence Logo |  |
| Technique(s) used for Glycosylation Detection | Concanavalin A (ConA)-binding, DIG glycan detection (labeling with digoxigenin-succinyl-epsilon-amidocaproic acid hydrazide and anti-DIG antibody after periodate oxidation) |
| Technique(s) used for Glycosylated Residue(s) Detection | Q-TOF nanoelectrospray MS-MS (hybrid quadrupole orthogonal acceleration time of flight), deletion analysis and site-directed mutagenesis |
| Protein Glycosylation- Implication | Glycosylation may function either as a signal for cleavage or as a means of preventing amino-terminal degradation of the protein following cleavage from its acylated anchor. This is because the 23-kDa form of MPB83 is generated by proteolytic cleavage immediately before Thr48 from the mature acylated 25-kDa form. |
| Glycan Information |
| Glycan Annotation | Linkage: Man-Thr.
3 mannose units present with Man(1→3)Man linkage. The dominant glycoform identified for MPB83 is Thr48 substituted with a single mannose residue and Thr49 substituted with a Man(1→3)Man linkage. However, evidence for a heterogeneous array of glycoforms from Thr48(Man3) Thr49(Man0) through to Thr48(Man0)Thr49(Man3) has also been observed. |
| Technique(s) used for Glycan Identification | Dionex ion chromatography of sugars after their release by acid hydrolysis, FAB-MS (fast atom bombardment-mass spectrometry) of permethylated O-glycans after their release by reductive elimination, and GC-MS linkage analysis of the partially methylated alditol acetates, derived from the permethylated products of reductive elimination. |
| Protein Glycosylation linked (PGL) gene(s) |
| OST Gene Name | |
| OST NCBI Gene ID | |
| OST GenBank Gene Sequence | |
| OST Protein Name | |
| OST UniProtKB/ SwissProt ID | |
| OST NCBI RefSeq | |
| OST EMBL-CDS | |
| OST UniProtKB Sequence | |
| OST EC Number (BRENDA) | |
| OST Genome Context | |
| Characterized Accessory Gene(s) | |
| PGL Additional Links | CAZy |
| Literatures |
| Reference(s) | 1) Michell, S.L., Whelan, A.O., Wheeler, P.R., Panico, M., Easton, R.L., Etienne, A.T., Haslam, S.M., Dell, A., Morris, H.R., Reason, A.J. et al. (2003) The MPB83 antigen from Mycobacterium bovis contains O-linked mannose and (1-->3)-mannobiose moieties. J Biol Chem, 278, 16423-16432. [PubMed: 12517764]
2) Fifis, T., Costopoulos, C., Radford, A.J., Bacic, A. and Wood, P.R. (1991) Purification and characterization of major antigens from a Mycobacterium bovis culture filtrate. Infect Immun, 5 |
| Additional Comments | 23-kDa is the predominant form of the antigen in the culture supernatant.
25/23-kDa antigen was misidentified as glycosylated form of MPB70. It is actually MPB83 antigen. |
| Year of Identification | 1991 |
| Year of Validation | 2003 |
