ProGlyProt ID BC152 Organism Information Organism Name Mycobacterium bovis AN5 Domain Bacteria Classification Family: Mycobacteriaceae Suborder: Corynebacterineae Order: Actinomycetales Subclass: Actinobacteridae Class: Actinobacteria Division or phylum: "Actinobacteria" Taxonomic ID (NCBI) 1765 Genome Sequence (s) GeneBank BX248344.1 EMBL BX248344 Gene Information Gene Name mpb83 (Mb2898) NCBI Gene ID 1092210 GenBank Gene Sequence 1092210 Protein Information Protein Name Cell surface lipoprotein MPB83 (25/23-kDa antigen UniProtKB/SwissProt ID P0CAX7 NCBI RefSeq NP_856543.1 EMBL-CDS CAD96585.1 UniProtKB Sequence >sp|P0CAX7|MP83_MYCBO Cell surface lipoprotein MPB83 OS=Mycobacterium bovis GN=mpb83 PE=4 SV=1 MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLI GRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGG EYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADL TVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ Sequence length 220 AA Subcellular Location Surface (membrane associated) Function Major immunodominant antigen. Protein Structure PDB ID Glycosylation Status Glycosylation Type O (Thr) linked Experimentally Validated Glycosite(s) in Full Length Protein T48, T49 Experimentally Validated Glycosite(s ) in Mature Protein T48, T49 Glycosite(s) Annotated Protein Sequence >sp|P0CAX7|MP83_MYCBO Cell surface lipoprotein MPB83 OS=Mycobacterium bovis GN=mpb83 PE=4 SV=1 MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVT*(48)T*(49)AAMADPAADLI GRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGG EYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADL TVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ Sequence Around Glycosites (21 AA) KPATSPAAPVTTAAMADPAAD PATSPAAPVTTAAMADPAADL Glycosite Sequence Logo seqlogo Glycosite Sequence Logo Technique(s) used for Glycosylation Detection Concanavalin A (ConA)-binding, DIG glycan detection (labeling with digoxigenin-succinyl-epsilon-amidocaproic acid hydrazide and anti-DIG antibody after periodate oxidation) Technique(s) used for Glycosylated Residue(s) Detection Q-TOF nanoelectrospray MS-MS (hybrid quadrupole orthogonal acceleration time of flight), deletion analysis and site-directed mutagenesis Protein Glycosylation- Implication Glycosylation may function either as a signal for cleavage or as a means of preventing amino-terminal degradation of the protein following cleavage from its acylated anchor. This is because the 23-kDa form of MPB83 is generated by proteolytic cleavage immediately before Thr48 from the mature acylated 25-kDa form. Glycan Information Glycan Annotation Linkage: Man-Thr. 3 mannose units present with Man(1→3)Man linkage. The dominant glycoform identified for MPB83 is Thr48 substituted with a single mannose residue and Thr49 substituted with a Man(1→3)Man linkage. However, evidence for a heterogeneous array of glycoforms from Thr48(Man3) Thr49(Man0) through to Thr48(Man0)Thr49(Man3) has also been observed. Technique(s) used for Glycan Identification Dionex ion chromatography of sugars after their release by acid hydrolysis, FAB-MS (fast atom bombardment-mass spectrometry) of permethylated O-glycans after their release by reductive elimination, and GC-MS linkage analysis of the partially methylated alditol acetates, derived from the permethylated products of reductive elimination. Protein Glycosylation linked (PGL) gene(s) OST Gene Name OST NCBI Gene ID OST GenBank Gene Sequence OST Protein Name OST UniProtKB/ SwissProt ID OST NCBI RefSeq OST EMBL-CDS OST UniProtKB Sequence OST EC Number (BRENDA) OST Genome Context Characterized Accessory Gene(s) PGL Additional Links CAZy Literatures Reference(s) 1) Michell, S.L., Whelan, A.O., Wheeler, P.R., Panico, M., Easton, R.L., Etienne, A.T., Haslam, S.M., Dell, A., Morris, H.R., Reason, A.J. et al. (2003) The MPB83 antigen from Mycobacterium bovis contains O-linked mannose and (1-->3)-mannobiose moieties. J Biol Chem, 278, 16423-16432. [PubMed: 12517764] 2) Fifis, T., Costopoulos, C., Radford, A.J., Bacic, A. and Wood, P.R. (1991) Purification and characterization of major antigens from a Mycobacterium bovis culture filtrate. Infect Immun, 5 Additional Comments 23-kDa is the predominant form of the antigen in the culture supernatant. 25/23-kDa antigen was misidentified as glycosylated form of MPB70. It is actually MPB83 antigen. Year of Identification 1991 Year of Validation 2003