| ProGlyProt ID | BC150 |
| Organism Information |
| Organism Name | Lactobacillus planta |
| Domain | Bacteria |
| Classification | Family: Lactobacillaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes" |
| Taxonomic ID (NCBI) | 1590 |
| Genome Sequence (s) |
| EMBL | GU552553 |
| Gene Information |
| Gene Name | gccF |
| NCBI Gene ID | |
| Protein Information |
| Protein Name | Glycocin F |
| UniProtKB/SwissProt ID | E9K9Z1 |
| NCBI RefSeq | |
| EMBL-CDS | ADV57366.1 |
| UniProtKB Sequence | >tr|E9K9Z1|E9K9Z1_LACPL Prebacteriocin glycocin F OS=Lactobacillus plantarum GN=gccF PE=4 SV=1
MSKLVKTLTISEISKAQNNGGKPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSS
SYHC |
| Sequence length | 64 AA |
| Subcellular Location | Secreted |
| Function | Glycocin F is a bacteriocin that possesses bacteriostatic activity. This activity is reversed by free N-acetylglucosamine. |
| Protein Structure |
| PDB ID | |
| Glycosylation Status |
| Glycosylation Type | O (Ser) linked and S (Cys) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | (Signal peptide: 1-21) S39, C64 |
| Experimentally Validated Glycosite(s ) in Mature Protein | S18, C43 |
| Glycosite(s) Annotated Protein Sequence | >tr|E9K9Z1|E9K9Z1_LACPL Prebacteriocin glycocin F OS=Lactobacillus plantarum GN=gccF PE=4 SV=1
MSKLVKTLTISEISKAQNNGGKPAWCWYTLAMCGAGYDS*(39)GTCDYMYSHCFGIKHHSSGSS
SYHC*(64)
|
| Sequence Around Glycosites (21 AA) | TLAMCGAGYDSGTCDYMYSHC
HHSSGSSSYHC
|
| Glycosite Sequence Logo | seqlogo |
| Glycosite Sequence Logo |  |
| Technique(s) used for Glycosylation Detection | Mass difference measured and accounted for by Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR-MS) with electron capture dissociation (ECD) |
| Technique(s) used for Glycosylated Residue(s) Detection | Edman sequencing and Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR-MS) |
| Protein Glycosylation- Implication | O-linked N-acetylglucosamine is required for bacteriostatic activity. |
| Glycan Information |
| Glycan Annotation | Linkages: β-GlcNAc-Ser, HexNAc-Cys.
N-Acetylglucosamine is β-O-linked to Ser18 and N-acetylhexosamine is S-linked to C-terminal Cys43. |
| Technique(s) used for Glycan Identification | N-acetyl-β-D-glucosaminidase GcnA treatment. |
| Protein Glycosylation linked (PGL) gene(s) |
| OST Gene Name | |
| OST NCBI Gene ID | |
| OST GenBank Gene Sequence | |
| OST Protein Name | |
| OST UniProtKB/ SwissProt ID | |
| OST NCBI RefSeq | |
| OST EMBL-CDS | |
| OST UniProtKB Sequence | |
| OST EC Number (BRENDA) | |
| OST Genome Context | |
| Characterized Accessory Gene(s) | |
| PGL Additional Links | CAZy |
| Literatures |
| Reference(s) | 1) Stepper, J., Shastri, S., Loo, T.S., Preston, J.C., Novak, P., Man, P., Moore, C.H., Havlicek, V., Patchett, M.L. and Norris, G.E. (2011) Cysteine S-glycosylation, a new post-translational modification found in glycopeptide bacteriocins. FEBS Lett, 585, 645-650. [PubMed: 21251913]
2) Venugopal, H., Edwards, P.J., Schwalbe, M., Claridge, J.K., Libich, D.S., Stepper, J., Loo, T., Patchett, M.L., Norris, G.E. and Pascal, S.M. (2011) Structural, dynamic, and chemical characterization of a no |
| Additional Comments | |
| Year of Identification | 2011 |
| Year of Validation | 2011 |
