| ProGlyProt ID | BC149 |
| Organism Information |
| Organism Name | Lactobacillus planta |
| Domain | Bacteria |
| Classification | Family: Lactobacillaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes" |
| Taxonomic ID (NCBI) | 1590 |
| Genome Sequence (s) |
| EMBL | AB474371 |
| Gene Information |
| Gene Name | bactA1 |
| NCBI Gene ID | |
| Protein Information |
| Protein Name | Plantaricin ASM1 |
| UniProtKB/SwissProt ID | C7G1H4 |
| NCBI RefSeq | |
| EMBL-CDS | BAH98036.1 |
| UniProtKB Sequence | >sp|C7G1H4|PASM1_LACPL Bacteriocin plantarican ASM1 OS=Lactobacillus plantarum GN=bactA1 PE=1 SV=1
MSKLVKTLTVDEISKIQTNGGKPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGG
SYHC |
| Sequence length | 64 AA |
| Subcellular Location | Secreted |
| Function | |
| Protein Structure |
| PDB ID | |
| Glycosylation Status |
| Glycosylation Type | O (Ser) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | (Signal peptide: 1-21) S61 |
| Experimentally Validated Glycosite(s ) in Mature Protein | S40 |
| Glycosite(s) Annotated Protein Sequence | >sp|C7G1H4|PASM1_LACPL Bacteriocin plantarican ASM1 OS=Lactobacillus plantarum GN=bactA1 PE=1 SV=1
MSKLVKTLTVDEISKIQTNGGKPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGG
S*(61)YHC
|
| Sequence Around Glycosites (21 AA) | GVKHSSGGGGSYHC |
| Glycosite Sequence Logo | seqlogo |
| Glycosite Sequence Logo |  |
| Technique(s) used for Glycosylation Detection | Difference between the theoretical and measured masses |
| Technique(s) used for Glycosylated Residue(s) Detection | Edman sequencing |
| Protein Glycosylation- Implication | |
| Glycan Information |
| Glycan Annotation | |
| Technique(s) used for Glycan Identification | |
| Protein Glycosylation linked (PGL) gene(s) |
| OST Gene Name | |
| OST NCBI Gene ID | |
| OST GenBank Gene Sequence | |
| OST Protein Name | |
| OST UniProtKB/ SwissProt ID | |
| OST NCBI RefSeq | |
| OST EMBL-CDS | |
| OST UniProtKB Sequence | |
| OST EC Number (BRENDA) | |
| OST Genome Context | |
| Characterized Accessory Gene(s) | |
| PGL Additional Links | CAZy |
| Literatures |
| Reference(s) | 1) Stepper, J., Shastri, S., Loo, T.S., Preston, J.C., Novak, P., Man, P., Moore, C.H., Havlicek, V., Patchett, M.L. and Norris, G.E. (2011) Cysteine S-glycosylation, a new post-translational modification found in glycopeptide bacteriocins. FEBS Lett, 585, 645-650. [PubMed: 21251913] |
| Additional Comments | |
| Year of Identification | 2011 |
| Year of Validation | 2011 |
