ProGlyProt ID | BC142 |
Organism Information |
Organism Name | Flavobacterium meningosepticum (Elizabethkingia meningoseptica) |
Domain | Bacteria |
Classification | Family: Flavobacteriaceae Order: "Flavobacteriales" Class: Flavobacteria Division or phylum: "Bacteroidetes" |
Taxonomic ID (NCBI) | 238 |
Genome Sequence (s) |
EMBL | L06331 |
Gene Information |
Gene Name | endO F2 |
NCBI Gene ID | |
Protein Information |
Protein Name | Endo-β-N-acetylglucosaminidase F2 |
UniProtKB/SwissProt ID | P36912 |
NCBI RefSeq | |
EMBL-CDS | AAA24923.1 |
UniProtKB Sequence | >sp|P36912|EBA2_FLAME Endo-beta-N-acetylglucosaminidase F2 OS=Flavobacterium meningosepticum GN=endOF2 PE=1 SV=1
MKTANFSFALCLSVVIMLFIKCTRSEQDLSVTKDAIAQKSGVTVSAVNLSNLIAYKNSDH
QISAGYYRTWRDSATASGNLPSMRWLPDSLDMVMVFPDYTPPENAYWNTLKTNYVPYLHK
RGTKVIITLGDLNSATTTGGQDSIGYSSWAKGIYDKWVGEYNLDGIDIDIESSPSGATLT
KFVAATKALSKYFGPKSGTGKTFVYDTNQNPTNFFIQTAPRYNYVFLQAYGRSTTNLTTV
SGLYAPYISMKQFLPGFSFYEENGYPGNYWNDVRYPQNGTGRAYDYARWQPATGKKGGVF
SYAIERDAPLTSSNDNTLRAPNFRVTKDLIKIMNP
|
Sequence length | 335 AA |
Subcellular Location | Periplasm (secreted) |
Function | Endohydrolysis of the di-N-acetylchitobiosyl unit in high-mannose glycopeptides and glycoproteins. Complex biantennary glycans are the preferred substrates. EC= 3.2.1.96. |
Protein Structure |
PDB ID | |
Glycosylation Status |
Glycosylation Type | O (Ser) linked |
Experimentally Validated Glycosite(s) in Full Length Protein | (Signal peptide: 1-45) S73, S89, S143
|
Experimentally Validated Glycosite(s ) in Mature Protein | S28, S44, S98
|
Glycosite(s) Annotated Protein Sequence | >sp|P36912|EBA2_FLAME Endo-beta-N-acetylglucosaminidase F2 OS=Flavobacterium meningosepticum GN=endOF2 PE=1 SV=1
MKTANFSFALCLSVVIMLFIKCTRSEQDLSVTKDAIAQKSGVTVSAVNLSNLIAYKNSDH
QISAGYYRTWRDS*(73)ATASGNLPSMRWLPDS*(89)LDMVMVFPDTPPENAYWNTLKTNYVPYLHK
RGTKVIITLGDLNSATTTGGQDS*(143)IGYSSWAKGIYDKWVGEYNLDGIDIDIESSPSGATLT
KFVAATKALSKYFGPKSGTGKTFVYDTNQNPTNFFIQTAPRYNYVFLQAYGRSTTNLTTV
SGLYAPYISMKQFLPGFSFYEENGYPGNYWNDVRYPQNGTGRAYDYARWQPATGKKGGVF
SYAIERDAPLTSSNDNTLRAPNFRVTKDLIKIMNP
|
Sequence Around Glycosites (21 AA) | SAGYYRTWRDSATASGNLPSM
NLPSMRWLPDSLDMVMVFPDY
NSATTTGGQDSIGYSSWAKGI
|
Glycosite Sequence Logo | seqlogo |
Glycosite Sequence Logo |  |
Technique(s) used for Glycosylation Detection | Mass shift detected on SDS-polyacrylamide gel and phenol-sulfuric acid assay |
Technique(s) used for Glycosylated Residue(s) Detection | Edman degradation and collision activated dissociation (CAD) mass spectrometry |
Protein Glycosylation- Implication | Glycosylation may contribute towards protein stability |
Glycan Information |
Glycan Annotation | Linkage: Man- Ser. Branched acidic, heptasaccharide (1244 Da) containing 3 different uronyl analogs (uronic acid derivatives), a methylated Rham and Man, a Glc, and a reducing terminal Man. Only pyranose ring forms were detected [(2-OMe)Man1-4GlcNAcU1-4GlcU1-4Glc1-4(2-OMe)GlcU-4[(2-OMe)Rham1-2]Man]. |
Technique(s) used for Glycan Identification | ESI-MS (electrospray ionization mass spectrometry), CID (collision-induced dissociation), and a combination of isotopic labeling, composition and methylation analysis. |
Protein Glycosylation linked (PGL) gene(s) |
OST Gene Name | |
OST NCBI Gene ID | |
OST GenBank Gene Sequence | |
OST Protein Name | |
OST UniProtKB/ SwissProt ID | |
OST NCBI RefSeq | |
OST EMBL-CDS | |
OST UniProtKB Sequence | |
OST EC Number (BRENDA) | |
OST Genome Context | |
Characterized Accessory Gene(s) | |
PGL Additional Links | CAZy |
Literatures |
Reference(s) | 1) Plummer, T.H., Jr., Tarentino, A.L. and Hauer, C.R. (1995) Novel, specific O-glycosylation of secreted Flavobacterium meningosepticum proteins. Asp-Ser and Asp-Thr-Thr consensus sites. J Biol Chem, 270, 13192-13196. [PubMed: 7768916] 2) Reinhold, B.B., Hauer, C.R., Plummer, T.H. and Reinhold, V.N. (1995) Detailed structural analysis of a novel, specific O-linked glycan from the prokaryote Flavobacterium meningosepticum. J Biol Chem, 270, 13197-13203. [PubMed: 7768917] 3) Tarentino, |
Additional Comments | Identified glycosylation Sequon features: Consensus sequon observed Asp-Ser (DS) or Asp-Thr-Thr (DTT), at turns. DT alone may not serve as a sequon. Interestingly, the experimentally examined other five nonglycosylated DT sequons were followed by N, D and Q. Post translational modification of 4-kDa was detected by MS in 1993 (Ref. no. 3). This PTM was seen on S28 and S44 by Edman degradation. The protein migrated slowly on SDS-PAGE (compared to its theoretical weight) and was found t |
Year of Identification | 1995 |
Year of Validation | 1995 |