ProGlyProt ID | BC117 |
Organism Information |
Organism Name | Campylobacter jejuni NCTC 11168 |
Domain | Bacteria |
Classification | Family: Campylobacteraceae Order: Campylobacterales Class: Epsilonproteobacteria Division or phylum: "Proteobacteria" |
Taxonomic ID (NCBI) | 197 |
Genome Sequence (s) |
EMBL | |
Gene Information |
Gene Name | |
NCBI Gene ID | |
Protein Information |
Protein Name | Synthetic Glycopeptide |
UniProtKB/SwissProt ID | Not Applicable |
NCBI RefSeq | |
EMBL-CDS | |
UniProtKB Sequence | KDFNVSKA |
Sequence length | 5 AA |
Subcellular Location | NA |
Function | NA |
Protein Structure |
PDB ID | |
Glycosylation Status |
Glycosylation Type | N (Asn) linked |
Experimentally Validated Glycosite(s) in Full Length Protein | N4 |
Experimentally Validated Glycosite(s ) in Mature Protein | N4 |
Glycosite(s) Annotated Protein Sequence | KDFN*(4)VSKA |
Sequence Around Glycosites (21 AA) | |
Glycosite Sequence Logo | seqlogo |
Glycosite Sequence Logo |  |
Technique(s) used for Glycosylation Detection | In vitro chemo enzymatic glycosylation,HPLC analysis of glycopeptides with reference to known glycopeptide HPLC profiles |
Technique(s) used for Glycosylated Residue(s) Detection | Not applicable |
Protein Glycosylation- Implication | Not applicable |
Glycan Information |
Glycan Annotation | GalNAc-α1,3-bacillosamine. |
Technique(s) used for Glycan Identification | |
Protein Glycosylation linked (PGL) gene(s) |
OST Gene Name | pglB |
OST NCBI Gene ID | 4682880 |
OST GenBank Gene Sequence | 4682880 |
OST Protein Name | PglB |
OST UniProtKB/ SwissProt ID | A1W0B2 |
OST NCBI RefSeq | YP_001000803.1 |
OST EMBL-CDS | EAQ72203.1 |
OST UniProtKB Sequence | >tr|A1W0B2|A1W0B2_CAMJJ General glycosylation pathway protein OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pglB PE=4 SV=1
MLKKEYLKNPYLVLFAMIVLAYVFSVLCRFYWIWWASEFNEYFFNNQLMIISNDGYAFAE
GARDMIAGFHQPNDLSYYGSSLSTLTYWLYKITPFSFESIILYMSTFLSSLVVIPIILLA
NEYKRPLMGFVAALLASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSL
IALPLFIGIYLWWYPSSYTLNVALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFY
QSTIIVILFALFALEQKRLNFVIIGILASVTLIFLILSGGVDPILYQLKFYIFRSDESAN
LTQGFMYFNVNQTIQEVENVDLSEFMRRISGSEIVFLFSLFGFVWLLRKHKSMIMALPIL
VLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAILVKKYSQLTSNVCIVFATILTLAPV
FIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGYPVRYYSDVKTLVDGGKHL
GKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKTDILQAMMKDYNQSNVDL
FLASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPL
DVKNGEIYLSNGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFY
LKDSAIPYAQFILMDKTMFNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI
|
OST EC Number (BRENDA) | 2.4.1.119 |
OST Genome Context | A1W0B2 |
Characterized Accessory Gene(s) | |
PGL Additional Links | CAZy |
Literatures |
Reference(s) | 1) Glover, K.J., Weerapana, E., Numao, S. and Imperiali, B. (2005) Chemoenzymatic synthesis of glycopeptides with PglB, a bacterial oligosaccharyl transferase from Campylobacter jejuni. Chem Biol, 12, 1311-1315. [PubMed: 16356848] |
Additional Comments | Engineered glycopeptide. In vitro characterization of the oligosaccharyl transferase activity of PglB protein from membrane fraction of Campylobacter jejuni using a synthetic disaccharide glycan donor (GalNAc-α1,3-bacillosamine-pyrophosphate-undecaprenyl) and a peptide acceptor substrate (KDFNVSKA). |
Year of Identification | 2005 |
Year of Validation | 2005 |