ProGlyProt ID BC117 Organism Information Organism Name Campylobacter jejuni NCTC 11168 Domain Bacteria Classification Family: Campylobacteraceae Order: Campylobacterales Class: Epsilonproteobacteria Division or phylum: "Proteobacteria" Taxonomic ID (NCBI) 197 Genome Sequence (s) EMBL Gene Information Gene Name NCBI Gene ID Protein Information Protein Name Synthetic Glycopeptide UniProtKB/SwissProt ID Not Applicable NCBI RefSeq EMBL-CDS UniProtKB Sequence KDFNVSKA Sequence length 5 AA Subcellular Location NA Function NA Protein Structure PDB ID Glycosylation Status Glycosylation Type N (Asn) linked Experimentally Validated Glycosite(s) in Full Length Protein N4 Experimentally Validated Glycosite(s ) in Mature Protein N4 Glycosite(s) Annotated Protein Sequence KDFN*(4)VSKA Sequence Around Glycosites (21 AA) Glycosite Sequence Logo seqlogo Glycosite Sequence Logo Technique(s) used for Glycosylation Detection In vitro chemo enzymatic glycosylation,HPLC analysis of glycopeptides with reference to known glycopeptide HPLC profiles Technique(s) used for Glycosylated Residue(s) Detection Not applicable Protein Glycosylation- Implication Not applicable Glycan Information Glycan Annotation GalNAc-α1,3-bacillosamine. Technique(s) used for Glycan Identification Protein Glycosylation linked (PGL) gene(s) OST Gene Name pglB OST NCBI Gene ID 4682880 OST GenBank Gene Sequence 4682880 OST Protein Name PglB OST UniProtKB/ SwissProt ID A1W0B2 OST NCBI RefSeq YP_001000803.1 OST EMBL-CDS EAQ72203.1 OST UniProtKB Sequence >tr|A1W0B2|A1W0B2_CAMJJ General glycosylation pathway protein OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pglB PE=4 SV=1 MLKKEYLKNPYLVLFAMIVLAYVFSVLCRFYWIWWASEFNEYFFNNQLMIISNDGYAFAE GARDMIAGFHQPNDLSYYGSSLSTLTYWLYKITPFSFESIILYMSTFLSSLVVIPIILLA NEYKRPLMGFVAALLASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSL IALPLFIGIYLWWYPSSYTLNVALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFY QSTIIVILFALFALEQKRLNFVIIGILASVTLIFLILSGGVDPILYQLKFYIFRSDESAN LTQGFMYFNVNQTIQEVENVDLSEFMRRISGSEIVFLFSLFGFVWLLRKHKSMIMALPIL VLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAILVKKYSQLTSNVCIVFATILTLAPV FIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGYPVRYYSDVKTLVDGGKHL GKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKTDILQAMMKDYNQSNVDL FLASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPL DVKNGEIYLSNGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFY LKDSAIPYAQFILMDKTMFNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI OST EC Number (BRENDA) 2.4.1.119 OST Genome Context A1W0B2 Characterized Accessory Gene(s) PGL Additional Links CAZy Literatures Reference(s) 1) Glover, K.J., Weerapana, E., Numao, S. and Imperiali, B. (2005) Chemoenzymatic synthesis of glycopeptides with PglB, a bacterial oligosaccharyl transferase from Campylobacter jejuni. Chem Biol, 12, 1311-1315. [PubMed: 16356848] Additional Comments Engineered glycopeptide. In vitro characterization of the oligosaccharyl transferase activity of PglB protein from membrane fraction of Campylobacter jejuni using a synthetic disaccharide glycan donor (GalNAc-α1,3-bacillosamine-pyrophosphate-undecaprenyl) and a peptide acceptor substrate (KDFNVSKA). Year of Identification 2005 Year of Validation 2005