ProGlyProt ID AC116 Organism Information Organism Name Methanococcus voltae Domain Archaea Classification Family: Methanococcaceae Order: Methanococcales Class: Methanococci or Methanothermea Division or phylum: "Euryarchaeota" Taxonomic ID (NCBI) 2188 Genome Sequence (s) EMBL M59200 Gene Information Gene Name sla NCBI Gene ID Protein Information Protein Name S-layer protein UniProtKB/SwissProt ID Q50833 NCBI RefSeq EMBL-CDS AAA93515.1 UniProtKB Sequence >sp|Q50833|CSG_METVO S-layer protein (Fragment) OS=Methanococcus voltae GN=sla PE=1 SV=2 KKIGAIAAGSAMVASALATGVFAVEKIGDVEGFKVIDNGEPTADIVVGSTAAAADVVSAA NVAAKVGSMMFKEGEAASGSAKLTVKASAESDDANLKSLLTNGTNDFTELDAGKEAFVVA AADSDYSDALINATTGFANIADNVLYDQAKLAAAVSLGDLSTLSVVKDIDPSDWYADKNK AADVATKDYYDQDGDAVEMLMATVASNDDGKSLTVDEDGVLYASIAYDDDNEDFQRATQV LKEGNRLPFLGEEYALVKLDTDDDIVYLGKEVFDGVLKEGDTYNIGDGYELKVVAILKSG DEYKISLQLMKDGKVVAEKFDKVSATSALKMIYTPGNIGIVVNEAWENVGQDYGYGSTLI TKDVIALELGEEYIPDWEVVTIEKDTTTDNTKDSKMTLSDDKITKDNTYGIGLQYVGDEE DNFKSGKAIKIAKYAELELDDEDKEDTKLNLFFSMDETKEATLAAGQKVTVLNSDITLSE VMADAKAPVAFKAPLAVLDTEVSLDAANKKLILVGGPVANALTKELADAGKIEMTVESPA TLAVVAGAANGNDVLVVAGGDRAATAEAANALIEML Sequence length 576 AA Subcellular Location Surface Function In Archaea, which do not possess other cell wall components, the S-layer has to maintain the cell integrity and stabilize as well as to protect the cell against mechanical and osmotic stresses or extreme pH conditions. It is also predicted that the S-layer has to maintain or even determine the cell shape. Protein Structure PDB ID Glycosylation Status Glycosylation Type N (Asn) linked Experimentally Validated Glycosite(s) in Full Length Protein (Signal peptide: 1-23) N102, also N132 in a second version of this strain (M. voltae PS*). Experimentally Validated Glycosite(s ) in Mature Protein N79, also N109 in a second version of this strain (M. voltae PS*). Glycosite(s) Annotated Protein Sequence >sp|Q50833|CSG_METVO S-layer protein (Fragment) OS=Methanococcus voltae GN=sla PE=1 SV=2 KKIGAIAAGSAMVASALATGVFAVEKIGDVEGFKVIDNGEPTADIVVGSTAAAADVVSAA NVAAKVGSMMFKEGEAASGSAKLTVKASAESDDANLKSLLTN*(102)GTNDFTELDAGKEAFVVA AADSDYSDALINATTGFANIADNVLYDQAKLAAAVSLGDLSTLSVVKDIDPSDWYADKNK AADVATKDYYDQDGDAVEMLMATVASNDDGKSLTVDEDGVLYASIAYDDDNEDFQRATQV LKEGNRLPFLGEEYALVKLDTDDDIVYLGKEVFDGVLKEGDTYNIGDGYELKVVAILKSG DEYKISLQLMKDGKVVAEKFDKVSATSALKMIYTPGNIGIVVNEAWENVGQDYGYGSTLI TKDVIALELGEEYIPDWEVVTIEKDTTTDNTKDSKMTLSDDKITKDNTYGIGLQYVGDEE DNFKSGKAIKIAKYAELELDDEDKEDTKLNLFFSMDETKEATLAAGQKVTVLNSDITLSE VMADAKAPVAFKAPLAVLDTEVSLDAANKKLILVGGPVANALTKELADAGKIEMTVESPA TLAVVAGAANGNDVLVVAGGDRAATAEAANALIEML Sequence Around Glycosites (21 AA) DDANLKSLLTNGTNDFTELDA ADSDYSDALINATTGFANIAD Glycosite Sequence Logo seqlogo Glycosite Sequence Logo Technique(s) used for Glycosylation Detection Glycan (779 Da) identification by nano-LC-MS/MS Technique(s) used for Glycosylated Residue(s) Detection Nano-LC-MS/MS (nano-liquid chromatography-electrospray tandem mass spectrometry) Protein Glycosylation- Implication Mutations that ultimately alter the structure of the S-layer protein could affect the protein interaction and disrupt the structural integrity of the cell. As a result, such mutants could suffer serious cell stability problems. It is this effect on the S-layer that likely explains why the agl mutants are so unstable. Glycan Information Glycan Annotation Linkage: β-GlcNAc-Asn. Trisaccharide (779 Da) composed of β-Manp NAcA6Thr-(1– 4)- β-Glcp NAc3NAcA-(1–3)-β-Glcp NAc. The sugars are mannuronic acid with the attached threonine, diacetylated glucuronic acid, N-acetylglucosamine. In a second version of this strain (M. voltae PS*), the glycan is modified with one additional residue (either 220 or 262 Da) linked to the terminal modified mannuronic acid. Technique(s) used for Glycan Identification NanoLC–MS/MS analysis and NMR spectroscopy- COSY (correlated spectroscopy), TOCSY (total correlation spectroscopy), NOESY (nuclear Overhauser effect spectroscopy) spectra, and 1H-13C HMBC (heteronuclear multiple bond coherence) spectra. Protein Glycosylation linked (PGL) gene(s) OST Gene Name aglB OST NCBI Gene ID OST GenBank Gene Sequence OST Protein Name AglB OST UniProtKB/ SwissProt ID Q2EMT4 OST NCBI RefSeq OST EMBL-CDS  ABD17750.1 OST UniProtKB Sequence >tr|Q2EMT4|Q2EMT4_METVO STT3 OS=Methanococcus voltae GN=MVO1749 PE=4 SV=1 MTENNEKVKNSDSANNQSSKNSKFNFNFEDKKVKCAKTILIIIFLAFLSFQMRAQTADMG FTTNEQYLDVFSDDNGRMYLTALDPYYYLRMSENYLENGHTGDTLKNIDGQQVPWDSYKY GPTGARATFNLLSVVTVWVYQVWHAMDSTVTLMNAAFWVPAILSMFLITPIFFTVRRITS SDIGGAVAAILASLSPSIFVKTVAGFSDTPILEILPLLFIVWFIIEAIHYSKEKNYKSLI YGLLATLMLALYPFMWSAWWYGYYIVIAFLVIYAIYKGISYNSIAKYTKSKNNNHKDKIE SEKLEMLNILKISGLFIIGGAVLITALYGVSTTMNALQAPLNYLGLDEVSSQTGWPNVLT TVSELDTASLDEIISSSLGSIHLFAIGLIGIFLSLFRKVLTPVKQISNGLAEKLDIKYAL LLIIWFAVTFLAASKGVRFVALMVPPLSIGVGIFVGFIEQFIKNNLDKKYEYVAYPTIAI IVLYALFTIYRADSADLVRMLLPSNYVPIAEGIMLASLAVLIIYKVAELIAESNKKLVMN KIFMILLAIGLITPTIATIVPFYSVPTYNDGWGESLEWINTQTPNNSVVTCWWDNGHIYT WKTDRMVTFDGSSQNTPRAYWVGRAFSTSNESLANGIFRMLASSGDKAYTTDSVLIKKTG SIKNTVDVLNEILPLTKSDAQKALKNSSYKFTDTEVSEILDATHPKVTNPDYLITYNRMT SIASVWSYFGNWDFNLPAGTSRSEREAGSFQGLQTYATNINDTLIVRSLIQQTAEYNIYT LIEVRNETLTGAMMAVTNDGQMQTQQLNMHKVKLMVNENGKSKMYNSLADPDGQLSLLIK VDKNSIIGTDGSNNPVYSSSSWMATANLEDSVYSKLHFFDGEGLDTIKLEKESLDPTANG VQPGFKVFSVD OST EC Number (BRENDA) OST Genome Context Characterized Accessory Gene(s) AglH, AglC, AglK, AglA glycosyltransferases are involved in the biosynthesis of the glycan. AglH is a GlcNAc-1-phosphate transferase transfering first sugar to dolichol pyrophosphate. AglC and AglK add the second sugar residue and AglA adds the third sugar to the glycan. Characterized by gene deletion studies PGL Additional Links CAZy Literatures Reference(s) 1) Chaban, B., Logan, S.M., Kelly, J.F. and Jarrell, K.F. (2009) AglC and AglK are involved in biosynthesis and attachment of diacetylated glucuronic acid to the N-glycan in Methanococcus voltae. J Bacteriol, 191, 187-195. [PubMed: 18978056] 2) Shams-Eldin, H., Chaban, B., Niehus, S., Schwarz, R.T. and Jarrell, K.F. (2008) Identification of the archaeal alg7 gene homolog (encoding N-acetylglucosamine-1-phosphate transferase) of the N-linked glycosylation system by cross-domain complementati Additional Comments Year of Identification 2005 Year of Validation 2005