ProGlyProt ID AC105 Organism Information Organism Name Halobacterium salinarum (halobium) R1M1/NRC-1 Domain Archaea Classification Family: Halobacteriaceae Order: Halobacteriales Class: Halobacteria or Halomebacteria Division or phylum: "Euryarchaeota" Taxonomic ID (NCBI) 64091 Genome Sequence (s) GeneBank AE004437.1 EMBL AE004437 Gene Information Gene Name flaB1 (VNG_0960G) NCBI Gene ID 1447685 GenBank Gene Sequence 1447685 Protein Information Protein Name Flagellin B1 UniProtKB/SwissProt ID P61116 NCBI RefSeq NP_279903.1 EMBL-CDS AAG19383.1 UniProtKB Sequence >sp|P61116|FLAB1_HALSA Flagellin B1 OS=Halobacterium salinarium (strain ATCC 700922 / JCM 11081 / NRC-1) GN=flaB1 PE=3 SV=1 MFEFITDEDERGQVGIGTLIVFIAMVLVAAIAAGVLINTAGYLQSKGSATGEEASAQVSN RINIVSAYGNVNNEKVDYVNLTVRQAAGADNINLTKSTIQWIGPDRATTLTYSSNSPSSL GENFTTESIKGSSADVLVDQSDRIKVIMYASGVSSNLGAGDEVQLTVTTQYGSKTTYWAQ VPESLKDKNAVTL Sequence length 193 AA Subcellular Location Flagellum Function Flagellin is the structural subunit of the flagellar filaments. Protein Structure PDB ID Glycosylation Status Glycosylation Type N (Asn) linked Experimentally Validated Glycosite(s) in Full Length Protein N93 Experimentally Validated Glycosite(s ) in Mature Protein N93 Glycosite(s) Annotated Protein Sequence >sp|P61116|FLAB1_HALSA Flagellin B1 OS=Halobacterium salinarium (strain ATCC 700922 / JCM 11081 / NRC-1) GN=flaB1 PE=3 SV=1 MFEFITDEDERGQVGIGTLIVFIAMVLVAAIAAGVLINTAGYLQSKGSATGEEASAQVSN RINIVSAYGNVNNEKVDYVNLTVRQAAGADNIN*(93)LTKSTIQWIGPDRATTLTYSSNSPSSL GENFTTESIKGSSADVLVDQSDRIKVIMYASGVSSNLGAGDEVQLTVTTQYGSKTTYWAQ VPESLKDKNAVTL Sequence Around Glycosites (21 AA) VRQAAGADNINLTKSTIQWIG Glycosite Sequence Logo seqlogo Glycosite Sequence Logo Technique(s) used for Glycosylation Detection Mass shift on SDS-PAGE after deglycosylation with anhydrous hydrogen fluoride. Technique(s) used for Glycosylated Residue(s) Detection Glycopeptide sequencing Protein Glycosylation- Implication Glycan Information Glycan Annotation Linkage: Glc-Asn. Sulfated oligosaccharides that resemble those of the cell-suface glycoprotein in the bacterium are present. Glucose and glucuronic acid are the constituents of the glycans which are of the type GlcA-(1→4)-GlcA-(1→4)-GlcA-(1→4)-Glc. Technique(s) used for Glycan Identification GLC-MS (gas liquid chromatography-mass spectrometry) after perfluoropropionylation. Protein Glycosylation linked (PGL) gene(s) OST Gene Name OST NCBI Gene ID OST GenBank Gene Sequence OST Protein Name OST UniProtKB/ SwissProt ID OST NCBI RefSeq OST EMBL-CDS OST UniProtKB Sequence OST EC Number (BRENDA) OST Genome Context Characterized Accessory Gene(s) PGL Additional Links CAZy Literatures Reference(s) 1) Cohen-Krausz, S. and Trachtenberg, S. (2002) The structure of the archeabacterial flagellar filament of the extreme halophile Halobacterium salinarum R1M1 and its relation to eubacterial flagellar filaments and type IV pili. J Mol Biol, 321, 383-395. [PubMed: 12162953] 2) Gerl, L., Deutzmann, R. and Sumper, M. (1989) Halobacterial flagellins are encoded by a multigene family. Identification of all five gene products. FEBS Lett, 244, 137-140. [PubMed: 2924901] 3) Gerl, L. and Sumper, M Additional Comments Removal of Mg++ ions in the growth medium inhibits glycosylation of proteins in vivo. This leads to the reduction in the molecular masses of newly synthesized flagellins. There might be another modification of the flagellins that is resistant to HF treatment. Halobacterial glycoproteins including flagellins are glycosylated at the extracellular surface of the cell membrane. Year of Identification 1985 Year of Validation 1988