| DB ID | MyCo_2756 |
| Title | Identification of a Novel Rhizopus-specific Antigen by Screening with a Signal Sequence Trap and Evaluation as a Possible Diagnostic Marker of Mucormycosis |
| Year | 2017 |
| PMID | 28199672 |
| Fungal Diseases involved | Mucormycosis |
| Associated Medical Condition | None |
| Genus | Rhizopus |
| Species | oryzae |
| Organism | Rhizopus oryzae |
| Ethical Statement | The experimental protocols were approved by the Ethics Re- view Committee for Animal Experimentation at Osaka City University. |
| Site of Infection | None |
| Opportunistic invasive | Opportunistic |
| Sample type | Body fluid |
| Sample source | Serum |
| Host Group | Animal |
| Host Common name | Mice |
| Host Scientific name | Mus musculus |
| Biomarker Name | Hypothetical protein-RSA (23 kDa) (RO3G_17119) |
| Biomarker Full Name | Hypothetical protein-RSA (23 kDa) |
| Biomarker Type | Diagnostic |
| Biomolecule | Protein |
| Geographical Location | Japan |
| Cohort | Six-week-old female Institute of Cancer Research (ICR) mice (>20 g) were purchased from SLC (Hamamatsu, Japan) and were allowed to acclimate for a week and were used in the study. |
| Cohort No. | None |
| Age Group | None |
| P Value | None |
| Sensitivity | None |
| Specificity | None |
| Positive Predictive Value | None |
| MIC | None |
| Fold Change | None |
| Pathway | None |
| Disease Introduction Mechanism | Invasive mould infections are frequently life-threatening in immunosuppressed hosts, such as patients with a hematological cancer, a solid organ transplant, uncontrolled di- abetes, or penetrating trauma. Invasive mucormycosis is the second most common mold infection after invasive aspergillosis (IA), and several studies showed increasing in- cidence of mucormycosis among the above-mentioned im- munocompromised patients. Timely surgical treatment of the site of mucormycosis, especially of the rhino-orbito- cerebral and soft tissue, is recommended to reduce the mass of the infecting mould and to prevent expansion of mucormycosis to adjacent structures. |
| Technique | ELISA |
| Analysis Method | ELISA Based Signal sequence trap by retrovirus-mediated expression (SST-REX) Assay |
| ELISA kits | sandwich ELISA. Mi- crotiter plates (Nunc MaxiSorp R , Thermo Fisher Scientific, Waltham, MA, USA) |
| Assay Data | None |
| Validation Techniques used | ELISA Based Signal sequence trap by retrovirus-mediated expression (SST-REX) Assay |
| Up Regulation Down Regulation | Increase |
| Sequence Data | Nucleotide sequence (678 nt) ATGAAGTTATCATTCTCTATCTTGCTCTTAGTTGCTGCTGTTCAAATTCAAGCTGCGTCAATCCTAAAGCTGCTGCTGCTTCCAAGTGCATTTCTGGCTCTTCTGGAAAGGTAATGGTGATGGTTACAAGGGTTACTGCTGCAAGGACAGCGATGATTGCTTTAAACCTGCGTGAAGGGTGTCTGCAATGGATCTTCCAAGCCTGATCCTACTCCTATCCACTCCTACTCCTGGAGGCAAGTGCACTCCTGGATCTAAAGGTCTTGGTAATGGTGATGGCTACAAGGGATACTGCTGTGATGATAGTGATGATTGTATTAACAGCTGTGTAAGCGGTGTCTGCAATGGTCCTACTAACACAGCAACCAAGACTACTACTACGAAACTACTACAGCCACCGCTACTGCTACCCCAGGCAAGTGTTCCCCTGGATCTCAAGGTCTCAAGAACGGCGATGGCTACAAGGGTGATTGTTGTGATACCAGCGATGATTGTGTGAACAGCTGTGTAAACGGTGTCTGCAATGGCGAAGTTAATCCTAATCCTAATCTGGTAAATGTATTCCTGGCTACAAGGACAAAGGCAATGGTAAGGGTCCCTTTAATGCATGCTGTTCAGATAATGACGACTGTCAAGAAGCCTGTGTCAGAGGCAGATGACCAAACCTTAA. Amino acid sequence (225 aa) MKLSFSILLLVAAVQIQAAVNPKAAAASKCISGSSGKGNGDGYKGYCCKDSDDCF TCVKGVCNGSSKPDPTPTPTPTPGGKCTPGSKGLGNGDGYKGYCCDDSDDCINSCVSGVCNGPTNTATKTTTTKTTTATATATPGKCSGSQGLKNGDGYKGDCCDTSDDCVNSCVNGVCNGEVNPNPNPGKCIPGYKDKGNGKGPFNACCSDNDDCQEACVRGRCTKP |
| External Link | None |
