| Primary information |
|---|
| ID | 17398 |
| Uniprot ID | O43915 |
| Description | Vascular endothelial growth factor D (VEGF-D) (c-Fos-induced growth factor) (FIGF) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Highly expressed in lung; heart; small intestine and fetal lung; and at lower levels in skeletal muscle; colon; and pancreas. |
| Post Translational Modification | Undergoes a complex proteolytic maturation which generates a variety of processed secreted forms with increased activity toward VEGFR-3 and VEGFR-2. VEGF-D first form an antiparallel homodimer linked |
| Function | Growth factor active in angiogenesis; lymphangiogenesis and endothelial cell growth; stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis; and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. |
| Length | 354 |
| Molecular Weight | 40444 |
| Name | Vascular endothelial growth factor D |
| Sequence | AATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR |
| Sequence map | 92-25 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P35968; P35916 |
| Domain | NA |
| Pharmaceutical Use | NA
|