| Primary information |
|---|
| ID | 17397 |
| Uniprot ID | P49767 |
| Description | Vascular endothelial growth factor C (VEGF-C) (Flt4 ligand) (Flt4-L) (Vascular endothelial growth factor-related protein) (VRP) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Spleen; lymph node; thymus; appendix; bone marrow; heart; placenta; ovary; skeletal muscle; prostate; testis; colon and small intestine and fetal liver; lung and kidney; but not in peripheral blood ly |
| Post Translational Modification | Undergoes a complex proteolytic maturation which generates a variety of processed secreted forms with increased activity toward VEGFR-3; but only the fully processed form could activate VEGFR-2. VEGF- |
| Function | Growth factor active in angiogenesis; and endothelial cell growth; stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis; and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors. |
| Length | 419 |
| Molecular Weight | 46883 |
| Name | Vascular endothelial growth factor C |
| Sequence | HYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR |
| Sequence map | 115-47 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P35968; P35916 |
| Domain | NA |
| Pharmaceutical Use | NA
|