| Primary information |
|---|
| ID | 17387 |
| Uniprot ID | O43508 |
| Description | Tumor necrosis factor ligand superfamily member 12 (APO3 ligand) (TNF-related weak inducer of apoptosis) (TWEAK) [Cleaved into- Tumor necrosis factor ligand superfamily member 12; membrane form; Tumor necrosis factor ligand superfamily member 12; secreted form] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Cell membrane |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Highly expressed in adult heart; pancreas; skeletal muscle; brain; colon; small intestine; lung; ovary; prostate; spleen; lymph node; appendix and peripheral blood lymphocytes. Low expression in kidne |
| Post Translational Modification | The soluble form derives from the membrane form by proteolytic processing. |
| Function | Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion. |
| Length | 249 |
| Molecular Weight | 27216 |
| Name | Tumor necrosis factor ligand superfamily member 12; membrane form |
| Sequence | AARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
| Sequence map | 05-09 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9NP84 |
| Domain | NA |
| Pharmaceutical Use | NA
|