| Primary information |
|---|
| ID | 17376 |
| Uniprot ID | P01135 |
| Description | Protransforming growth factor alpha [Cleaved into- Transforming growth factor alpha (TGF-alpha) (EGF-like TGF) (ETGF) (TGF type 1)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | [Transforming growth factor alpha]- Secreted; extracellular space.; [Protransforming growth factor a |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Isoform 1; isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines. |
| Post Translational Modification | NA |
| Function | TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar. |
| Length | 160 |
| Molecular Weight | 17006 |
| Name | Protransforming growth factor alpha |
| Sequence | NSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV |
| Sequence map | 26-40 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P78536; P21926; P00533 |
| Domain | NA |
| Pharmaceutical Use | NA
|