| Primary information |
|---|
| ID | 17372 |
| Uniprot ID | Q92583 |
| Description | C-C motif chemokine 17 (CC chemokine TARC) (Small-inducible cytokine A17) (Thymus and activation-regulated chemokine) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed at high levels in thymus and at low levels in the lung; colon and small intestine. |
| Post Translational Modification | NA |
| Function | Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4. |
| Length | 94 |
| Molecular Weight | 10507 |
| Name | C-C motif chemokine 17 |
| Sequence | RGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS |
| Sequence map | 25-34 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P51679 |
| Domain | NA |
| Pharmaceutical Use | NA
|