| Primary information |
|---|
| ID | 17352 |
| Uniprot ID | P13501 |
| Description | C-C motif chemokine 5 (EoCP) (Eosinophil chemotactic cytokine) (SIS-delta) (Small-inducible cytokine A5) (T cell-specific protein P228) (TCP228) (T-cell-specific protein RANTES) [Cleaved into- RANTES(3-68); RANTES(4-68)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in the follicular fluid |
| Post Translational Modification | N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage; probably by DPP4; after secretion from peripheral blood leukocytes and cultured sarcoma cells. |
| Function | Chemoattractant for blood monocytes; memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1; CCR3; CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1; HIV-2; and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) |
| Length | 91 |
| Molecular Weight | 9990 |
| Name | C-C motif chemokine 5 |
| Sequence | PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Sequence map | 25-31 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P32246; P51677; P51681; O00590 |
| Domain | NA |
| Pharmaceutical Use | NA
|