Primary information |
---|
ID | 17348 |
Uniprot ID | P49763-3 |
Description | Placenta growth factor (PlGF) |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted Note=The three isoforms are secreted but PlGF-2 appears to remain cell attached unless rele |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | While the three isoforms are present in most placental tissues; PlGF-2 is specific to early |
Post Translational Modification | N-glycosylated. |
Function | Growth factor active in angiogenesis and endothelial cell growth; stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth. |
Length | 221 |
Molecular Weight | 24789 |
Name | Placenta growth factor |
Sequence | PAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR |
Sequence map | 22-41 |
PDB ID | NA |
Drugpedia | NA |
Receptor | P17948; Q9H2E2; O14786 |
Domain | Isoform PlGF-2 contains a basic insert which acts |
Pharmaceutical Use | NA
|