| Primary information |
|---|
| ID | 17338 |
| Uniprot ID | Q9NRA1 |
| Description | Platelet-derived growth factor C (PDGF-C) (Fallotein) (Spinal cord-derived growth factor) (SCDGF) (VEGF-E) [Cleaved into- Platelet-derived growth factor C; latent form (PDGFC latent form); Platelet-derived growth factor C; receptor-binding form (PDGFC receptor-binding form)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Cytoplasm; cytosol |
| Developmental Stage | In the fetal kidney; detected in the developing mesangium; ureteric bud epithelium and the undifferentiated mesenchyme (at protein level). |
| Similarity | NA |
| Tissue Specificity | Expressed in the fallopian tube; vascular smooth muscle cells in kidney; breast and colon and in visceral smooth muscle of the gastrointestinal tract. Highly expressed in retinal pigment epithelia. Ex |
| Post Translational Modification | Proteolytic removal of the N-terminal CUB domain releasing the core domain is necessary for unmasking the receptor-binding epitopes of the core domain. Cleavage after basic residues in the hinge regio |
| Function | Growth factor that plays an essential role in the regulation of embryonic development; cell proliferation; cell migration; survival and chemotaxis. Potent mitogen and chemoattractant for cells of mesenchymal origin. Required for normal skeleton formation during embryonic development; especially for normal development of the craniofacial skeleton and for normal development of the palate. Required for normal skin morphogenesis during embryonic development. Plays an important role in wound healing; where it appears to be involved in three stages- inflammation; proliferation and remodeling. Plays an important role in angiogenesis and blood vessel development. Involved in fibrotic processes; in which transformation of interstitial fibroblasts into myofibroblasts plus collagen deposition occurs. The CUB domain has mitogenic activity in coronary artery smooth muscle cells; suggesting a role beyond the maintenance of the latency of the PDGF domain. In the nucleus; PDGFC seems to have additiona |
| Length | 345 |
| Molecular Weight | 39029 |
| Name | Platelet-derived growth factor C; latent form |
| Sequence | SNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG |
| Sequence map | 28-45 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P16234 |
| Domain | NA |
| Pharmaceutical Use | NA
|