| Primary information |
|---|
| ID | 17336 |
| Uniprot ID | P55774 |
| Description | C-C motif chemokine 18 (Alternative macrophage activation-associated CC chemokine 1) (AMAC-1) (CC chemokine PARC) (Dendritic cell chemokine 1) (DC-CK1) (Macrophage inflammatory protein 4) (MIP-4) (Pulmonary and activation-regulated chemokine) (Small-inducible cytokine A18) [Cleaved into- CCL18(1-68) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed at high levels in lung; lymph nodes; placenta; bone marrow; dendritic cells present in germinal centers and T-cell areas of secondary lymphoid organs and macrophages derived from peripheral |
| Post Translational Modification | The Cys-30/Cys-54 disulfide bond is required for activity. |
| Function | Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes; has chemotactic activity for naive T-cells; CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. |
| Length | 89 |
| Molecular Weight | 9849 |
| Name | C-C motif chemokine 18 |
| Sequence | QVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
| Sequence map | 22-29 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P51677 |
| Domain | NA |
| Pharmaceutical Use | NA
|