| Primary information |
|---|
| ID | 17333 |
| Uniprot ID | P02818 |
| Description | Osteocalcin (Bone Gla protein) (BGP) (Gamma-carboxyglutamic acid-containing protein) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium. |
| Function | Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. |
| Length | 100 |
| Molecular Weight | 10963 |
| Name | Osteocalcin |
| Sequence | LYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
| Sequence map | 53-40 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q5T6X5 |
| Domain | NA |
| Pharmaceutical Use | NA
|