| Primary information |
|---|
| ID | 17326 |
| Uniprot ID | Q8WWG1 |
| Description | Pro-neuregulin-4; membrane-bound isoform (Pro-NRG4) [Cleaved into- Neuregulin-4 (NRG-4)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | [Pro-neuregulin-4; membrane-bound isoform]- Cell membrane |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form. |
| Function | Low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors; resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Does not bind to the ERBB1; ERBB2 and ERBB3 receptors. |
| Length | 115 |
| Molecular Weight | 12722 |
| Name | Pro-neuregulin-4; membrane-bound isoform |
| Sequence | PTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH |
| Sequence map | 2-55 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q15303 |
| Domain | The cytoplasmic domain may be involved in the regu |
| Pharmaceutical Use | NA
|