| Primary information |
|---|
| ID | 17312 |
| Uniprot ID | P21741 |
| Description | Midkine (MK) (Amphiregulin-associated protein) (ARAP) (Midgestation and kidney protein) (Neurite outgrowth-promoting factor 2) (Neurite outgrowth-promoting protein) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in various tumor cell lines. In insulinoma tissue predominantly expressed in precancerous lesions. |
| Post Translational Modification | NA |
| Function | Secreted that functions as cytokine and growth factor and mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors |
| Length | 143 |
| Molecular Weight | 15585 |
| Name | Midkine |
| Sequence | AKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD |
| Sequence map | 23-23 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P23467 |
| Domain | NA |
| Pharmaceutical Use | NA
|