| Primary information |
|---|
| ID | 17304 |
| Uniprot ID | O00626 |
| Description | C-C motif chemokine 22 (CC chemokine STCP-1) (MDC(1-69)) (Macrophage-derived chemokine) (Small-inducible cytokine A22) (Stimulated T-cell chemotactic protein 1) [Cleaved into- MDC(3-69); MDC(5-69); MDC(7-69)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Highly expressed in macrophage and in monocyte-derived dendritic cells; and thymus. Also found in lymph node; appendix; activated monocytes; resting and activated macrophages. Lower expression in lung |
| Post Translational Modification | The N-terminal processed forms MDC(3-69); MDC(5-69) and MDC(7-69) are produced by proteolytic cleavage after secretion from monocyte derived dendrocytes. |
| Function | May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes; dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils; eosinophils; and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69); MDC(5-69) and MDC(7-69) seem not be active. |
| Length | 93 |
| Molecular Weight | 10625 |
| Name | C-C motif chemokine 22 |
| Sequence | PYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ |
| Sequence map | 26-33 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P51679 |
| Domain | NA |
| Pharmaceutical Use | NA
|