| Primary information |
|---|
| ID | 17302 |
| Uniprot ID | Q99616 |
| Description | C-C motif chemokine 13 (CK-beta-10) (Monocyte chemoattractant protein 4) (Monocyte chemotactic protein 4) (MCP-4) (NCC-1) (Small-inducible cytokine A13) [Cleaved into- C-C motif chemokine 13; long chain; C-C motif chemokine 13; medium chain; C-C motif chemokine 13; short chain] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Widely expressed. Found in small intestine; thymus; colon; lung; trachea; stomach and lymph node. Low levels seen in the pulmonary artery smooth muscle cells. |
| Post Translational Modification | One major form (form long); and two minor forms (short chain and medium chain) are produced by differential signal peptide cleavage. The medium chain is about 30-fold less active than the long chain. |
| Function | Chemotactic factor that attracts monocytes; lymphocytes; basophils and eosinophils; but not neutrophils. Signals through CCR2B and CCR3 receptors. Plays a role in the accumulation of leukocytes at both sides of allergic and non-allergic inflammation. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis. May play a role in the monocyte attraction in tissues chronically exposed to exogenous pathogens. |
| Length | 98 |
| Molecular Weight | 10986 |
| Name | C-C motif chemokine 13; long chain |
| Sequence | NPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
| Sequence map | 18-38 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9NPB9; P41597; P51677 |
| Domain | NA |
| Pharmaceutical Use | NA
|