| Primary information |
|---|
| ID | 17300 |
| Uniprot ID | P80075 |
| Description | C-C motif chemokine 8 (HC14) (Monocyte chemoattractant protein 2) (Monocyte chemotactic protein 2) (MCP-2) (Small-inducible cytokine A8) [Cleaved into- MCP-2(6-76)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart; placenta; lung; skeletal muscle; thymus; colon; ovary; spinal cord and pancreas. Low |
| Post Translational Modification | N-terminal processed form MCP-2(6-76) is produced by proteolytic cleavage after secretion from peripheral blood monocytes. |
| Function | Chemotactic factor that attracts monocytes; lymphocytes; basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity; but inhibits the chemotactic effect most predominantly of CCL7; and also of CCL2 and CCL5 and CCL8. |
| Length | 99 |
| Molecular Weight | 11246 |
| Name | C-C motif chemokine 8 |
| Sequence | PDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
| Sequence map | 25-39 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9NPB9 |
| Domain | NA |
| Pharmaceutical Use | NA
|