| Primary information |
|---|
| ID | 17299 |
| Uniprot ID | O43557 |
| Description | Tumor necrosis factor ligand superfamily member 14 (Herpes virus entry mediator ligand) (HVEM-L) (Herpesvirus entry mediator ligand) (CD antigen CD258) [Cleaved into- Tumor necrosis factor ligand superfamily member 14; membrane form; Tumor necrosis factor ligand superfamily member 14; soluble form] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | [Tumor necrosis factor ligand superfamily member 14; membrane form]- Cell membrane; Single-pass type |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Predominantly expressed in the spleen but also found in the brain. Weakly expressed in peripheral lymphoid tissues and in heart; placenta; liver; lung; appendix; and kidney; and no expression seen in |
| Post Translational Modification | N-glycosylated. |
| Function | Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM |
| Length | 240 |
| Molecular Weight | 26350 |
| Name | Tumor necrosis factor ligand superfamily member 14; membrane form |
| Sequence | EESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
| Sequence map | 5 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q92956; P36941 |
| Domain | NA |
| Pharmaceutical Use | NA
|