Primary information |
---|
ID | 17297 |
Uniprot ID | P02778 |
Description | C-X-C motif chemokine 10 (10 kDa interferon gamma-induced protein) (Gamma-IP10) (IP-10) (Small-inducible cytokine B10) [Cleaved into- CXCL10(1-73)] |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | Mainly secreted by monocytes; endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus |
Post Translational Modification | Several proteases can mediate post-secretion cleavages. DPP4 cleaves CXCL10 on its N-terminal 2 amino acids leading to an antagonist form of CXCL10. This dominant negative form is capable of binding C |
Function | Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis; differentiation; and activation of peripheral immune cells; regulation of cell growth; apoptosis and modulation of angiostatic effects |
Length | 98 |
Molecular Weight | 10881 |
Name | C-X-C motif chemokine 10 |
Sequence | PLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Sequence map | 23-38 |
PDB ID | NA |
Drugpedia | NA |
Receptor | P51677; P49682 |
Domain | NA |
Pharmaceutical Use | NA
|