Primary information |
---|
ID | 17286 |
Uniprot ID | Q8IZJ0 |
Description | Interferon lambda-2 (IFN-lambda-2) (Cytokine Zcyto20) (Interleukin-28A) (IL-28A) |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Cytokine with antiviral; antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense; predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1; and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG); which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets- is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Seems not to be essential for early virus-activated host defense in vaginal infection; but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expressio |
Length | 200 |
Molecular Weight | 22288 |
Name | Interferon lambda-2 |
Sequence | PVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV |
Sequence map | 29-20 |
PDB ID | NA |
Drugpedia | NA |
Receptor | Q08334; Q8IU57-1 |
Domain | NA |
Pharmaceutical Use | NA
|