| Primary information |
|---|
| ID | 17282 |
| Uniprot ID | Q9NYY1 |
| Description | Interleukin-20 (IL-20) (Cytokine Zcyto10) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in most tissues and five major cell types- epithelial cells |
| Post Translational Modification | NA |
| Function | Pro-inflammatory and angiogenic cytokine mainly secreted by monocytes and skin keratinocytes that plays crucial roles in immune responses; regulation of inflammatory responses; hemopoiesis; as well as epidermal cell and keratinocyte differentiation |
| Length | 176 |
| Molecular Weight | 20072 |
| Name | Interleukin-20 |
| Sequence | KTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE |
| Sequence map | 27-56 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9UHF4; Q6UXL0; Q8N6P7 |
| Domain | NA |
| Pharmaceutical Use | NA
|