| Primary information |
|---|
| ID | 17277 |
| Uniprot ID | Q9NZH6 |
| Description | Interleukin-37 (IL-37) (FIL1 zeta) (IL-1X) (Interleukin-1 family member 7) (IL-1F7) (Interleukin-1 homolog 4) (IL-1H) (IL-1H4) (Interleukin-1 zeta) (IL-1 zeta) (Interleukin-1-related protein) (IL-1RP1) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Cytoplasm; cytosol |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | In general; low constitutive expression; if any; in healthy tissues; high expression in inflammatory counterparts; including in synovial tissues from individuals with active rheumatoid arthritis. Isof |
| Post Translational Modification | Proteolytically converted to the mature form by CASP1. |
| Function | Immune regulatory cytokine that acts as a suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. Signaling can occur via two mechanisms; intracellularly through nuclear translocation with SMAD3 and extracellularly after secretion and binding to its receptor composed of IL18R1 and IL18RAP. Suppresses; or reduces; pro-inflammatory cytokine production; including IL1A and IL6; as well as CCL12; CSF1; CSF2; CXCL13; IL1B; IL23A and IL1RN; but spares anti-inflammatory cytokines. Inhibits dendritic cell activation. |
| Length | 218 |
| Molecular Weight | 24126 |
| Name | Interleukin-37 |
| Sequence | HTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
| Sequence map | 49-38 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9NRM6 |
| Domain | NA |
| Pharmaceutical Use | NA
|