| Primary information |
|---|
| ID | 17273 |
| Uniprot ID | Q9H293 |
| Description | Interleukin-25 (IL-25) (Interleukin-17E) (IL-17E) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed at low levels in several tissues; including brain; kidney; lung; prostate; testis; spinal cord; adrenal gland; and trachea. |
| Post Translational Modification | NA |
| Function | Cytokine produced by various cells such as eosinophils; T-helper type 2 (Th2) cells or epithelial cells that plays a role in internal safety of adaptive immune responses by regulating cytokine production |
| Length | 177 |
| Molecular Weight | 20330 |
| Name | Interleukin-25 |
| Sequence | SHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG |
| Sequence map | 35-57 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9NRM6 |
| Domain | NA |
| Pharmaceutical Use | NA
|