| Primary information |
|---|
| ID | 17271 |
| Uniprot ID | Q9UHF5 |
| Description | Interleukin-17B (IL-17B) (Cytokine Zcyto7) (Interleukin-20) (IL-20) (Neuronal interleukin-17-related factor) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in adult pancreas; small intestine; stomach; spinal cord and testis. Less pronounced expression in prostate; colon mucosal lining; and ovary. |
| Post Translational Modification | NA |
| Function | Stimulates the release of tumor necrosis factor alpha and IL-1-beta from the monocytic cell line THP-1. |
| Length | 180 |
| Molecular Weight | 20437 |
| Name | Interleukin-17B |
| Sequence | PRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF |
| Sequence map | 24 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q96F46; Q9NRM6 |
| Domain | NA |
| Pharmaceutical Use | NA
|