| Primary information |
|---|
| ID | 17270 |
| Uniprot ID | Q16552 |
| Description | Interleukin-17A (IL-17) (IL-17A) (Cytotoxic T-lymphocyte-associated antigen 8) (CTLA-8) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in memory Th17 cells |
| Post Translational Modification | N-glycosylated. Found both in glycosylated and nonglycosylated forms. |
| Function | Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity |
| Length | 155 |
| Molecular Weight | 17504 |
| Name | Interleukin-17A |
| Sequence | ITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Sequence map | 26-35 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q96F46 |
| Domain | NA |
| Pharmaceutical Use | NA
|