| Primary information |
|---|
| ID | 17269 |
| Uniprot ID | P40933 |
| Description | Interleukin-15 (IL-15) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | [Isoform IL15-S48AA]- Secreted; [Isoform IL15-S21AA]- Cytoplasm. Nucleus. Note=IL15-S21AA is not sec |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Most abundant in placenta and skeletal muscle. It is also detected in the heart; lung; liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus. |
| Post Translational Modification | NA |
| Function | Cytokine that plays a major role in the development of inflammatory and protective immune responses to microbial invaders and parasites by modulating immune cells of both the innate and adaptive immune systems |
| Length | 162 |
| Molecular Weight | 18086 |
| Name | Interleukin-15 |
| Sequence | WVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Sequence map | 51-42 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q13261 |
| Domain | NA |
| Pharmaceutical Use | NA
|