| Primary information |
|---|
| ID | 17267 |
| Uniprot ID | P22301 |
| Description | Interleukin-10 (IL-10) (Cytokine synthesis inhibitory factor) (CSIF) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Produced by a variety of cell lines; including T-cells; macrophages; mast cells and other cell types. |
| Post Translational Modification | NA |
| Function | Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions; limiting excessive tissue disruption caused by inflammation. Mechanistically; IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3 |
| Length | 178 |
| Molecular Weight | 20517 |
| Name | Interleukin-10 |
| Sequence | PGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
| Sequence map | 21-58 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q13651; Q08334 |
| Domain | NA |
| Pharmaceutical Use | NA
|